Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_070218281            1079 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108067453), transcript variant X2, mRNA.
ACCESSION   XM_070218281
VERSION     XM_070218281.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1079
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1079
                     /gene="LOC108067453"
                     /note="uncharacterized LOC108067453; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108067453"
     CDS             311..718
                     /gene="LOC108067453"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_070074382.1"
                     /db_xref="GeneID:108067453"
                     /translation="MKPELAVNADDDFPIKTEEELVEVDEKISQDSTIYVTSIKKLLS
                     RGRASRTIRLIFGDEIILAYNIDGAKNKKRLKDHTYLFRALMDAIGQIETKEPSERVL
                     SKAMRCVKNYACKNKSRVGEEDPLSFLDVELDK"
     misc_feature    335..568
                     /gene="LOC108067453"
                     /note="Domain of unknown function (DUF4806); Region:
                     DUF4806; pfam16064"
                     /db_xref="CDD:465001"
ORIGIN      
        1 ctgtttgctt gctgaaagga atgatgaagc atcgatgaat tgcagctgcc aaactgcaga
       61 gcaagccctc gggatattat cagtattaat atgcacacaa tgaagaagga atcagggccg
      121 atgaccaaac ggattcgcat cgaaagcgtt cgcacccttg gcgacgaaaa cgtgcacagc
      181 ctaggcgaag aaaacgatct cctgattgca aagatatgcg accgaagtat tggcccagcg
      241 cgcagaaatc cggcaattga caaaggcggt agctacgctt acggacatcg taaagaagac
      301 gatcaggacg atgaaaccgg aattagcggt caatgcagat gacgatttcc ccattaaaac
      361 ggaggaggag ctagtcgaag tggacgagaa gataagccag gactccacga tctatgtcac
      421 gtccattaag aaattgttga gccggggcag ggcaagccga accataagac taattttcgg
      481 cgatgaaatc attttagcct ataatattga cggagcgaag aacaagaaaa gactgaagga
      541 ccatacatat ctgtttcgcg ctctgatgga tgccatcggt caaattgaga ccaaggagcc
      601 ttccgaaagg gtattgtcca aagcaatgag atgcgttaag aactacgctt gcaaaaacaa
      661 gagcagggtc ggtgaggagg atcctctgtc ctttttggac gtggaattgg acaaataatt
      721 agtatattga ctattgactg ctaaggagtc caaaatgtag atgaataagt ctatgggagc
      781 tattctgggt attccctaaa ctgttgaatt gctgaattgt tgaattttgg tcagctgtta
      841 atcagctgtt acaaagtcaa ctttcagaaa tttcacaaat tttcaattgc tgaaaagcca
      901 gagttgtcac ctctttatta aaagtcatgg caactcagta acgtttaagt atcgtcagta
      961 tgcattattt atttaaaaat caacttagaa agcatatttg tggttttttt tagcttggta
     1021 accattttag acagtaacta gcaataataa ataaaattgt acatgcttta agttccgtg