Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218281 1079 bp mRNA linear INV 09-DEC-2024 (LOC108067453), transcript variant X2, mRNA. ACCESSION XM_070218281 VERSION XM_070218281.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1079 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1079 /gene="LOC108067453" /note="uncharacterized LOC108067453; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108067453" CDS 311..718 /gene="LOC108067453" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_070074382.1" /db_xref="GeneID:108067453" /translation="MKPELAVNADDDFPIKTEEELVEVDEKISQDSTIYVTSIKKLLS RGRASRTIRLIFGDEIILAYNIDGAKNKKRLKDHTYLFRALMDAIGQIETKEPSERVL SKAMRCVKNYACKNKSRVGEEDPLSFLDVELDK" misc_feature 335..568 /gene="LOC108067453" /note="Domain of unknown function (DUF4806); Region: DUF4806; pfam16064" /db_xref="CDD:465001" ORIGIN 1 ctgtttgctt gctgaaagga atgatgaagc atcgatgaat tgcagctgcc aaactgcaga 61 gcaagccctc gggatattat cagtattaat atgcacacaa tgaagaagga atcagggccg 121 atgaccaaac ggattcgcat cgaaagcgtt cgcacccttg gcgacgaaaa cgtgcacagc 181 ctaggcgaag aaaacgatct cctgattgca aagatatgcg accgaagtat tggcccagcg 241 cgcagaaatc cggcaattga caaaggcggt agctacgctt acggacatcg taaagaagac 301 gatcaggacg atgaaaccgg aattagcggt caatgcagat gacgatttcc ccattaaaac 361 ggaggaggag ctagtcgaag tggacgagaa gataagccag gactccacga tctatgtcac 421 gtccattaag aaattgttga gccggggcag ggcaagccga accataagac taattttcgg 481 cgatgaaatc attttagcct ataatattga cggagcgaag aacaagaaaa gactgaagga 541 ccatacatat ctgtttcgcg ctctgatgga tgccatcggt caaattgaga ccaaggagcc 601 ttccgaaagg gtattgtcca aagcaatgag atgcgttaag aactacgctt gcaaaaacaa 661 gagcagggtc ggtgaggagg atcctctgtc ctttttggac gtggaattgg acaaataatt 721 agtatattga ctattgactg ctaaggagtc caaaatgtag atgaataagt ctatgggagc 781 tattctgggt attccctaaa ctgttgaatt gctgaattgt tgaattttgg tcagctgtta 841 atcagctgtt acaaagtcaa ctttcagaaa tttcacaaat tttcaattgc tgaaaagcca 901 gagttgtcac ctctttatta aaagtcatgg caactcagta acgtttaagt atcgtcagta 961 tgcattattt atttaaaaat caacttagaa agcatatttg tggttttttt tagcttggta 1021 accattttag acagtaacta gcaataataa ataaaattgt acatgcttta agttccgtg