Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Copper transporter 1A (Ctr1A),


LOCUS       XM_070218280            1377 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X5, mRNA.
ACCESSION   XM_070218280
VERSION     XM_070218280.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1377
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1377
                     /gene="Ctr1A"
                     /note="Copper transporter 1A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108067755"
     CDS             270..941
                     /gene="Ctr1A"
                     /codon_start=1
                     /product="high affinity copper uptake protein 1 isoform
                     X2"
                     /protein_id="XP_070074381.1"
                     /db_xref="GeneID:108067755"
                     /translation="MDHAHHHDHMHHAAAMETTSPSTALNDMIPDDSDLQAALAGGHG
                     HDHMSHEHMGHGMGHHGGSGTGMEHMMPMAFHFGYNETILFSWWHIETVAGLVGSMIA
                     IFLLALMYEGLKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAAPSPVQPSM
                     LSVNHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDV
                     TEHCH"
     misc_feature    486..893
                     /gene="Ctr1A"
                     /note="Ctr copper transporter family; Region: Ctr;
                     pfam04145"
                     /db_xref="CDD:461194"
     polyA_site      1377
                     /gene="Ctr1A"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtcatttct tagtaccttt ttgagtgcac tactattaaa taaaaaaaac atatgttccc
       61 aattaattca tcaaaccaac aatcgtgcga acaagttgtc tgcgggcgga cgtggtgcac
      121 attttgtttt gtttttattt aggaaataac ataacccaga cattccgttg aattcgccac
      181 ttaaaccggc attacaacat tgttgcaaca aatcgcccgc ccaattgcat cattaatcgc
      241 gaattcgcag tgggaagaca tcagcagtta tggaccacgc ccatcatcac gatcatatgc
      301 accacgcggc agcgatggaa accacctcgc ccagcacggc cttgaatgac atgattcccg
      361 acgacagtga tttgcaagca gctctggcgg gcggtcacgg tcacgatcac atgagtcacg
      421 agcacatggg tcacggaatg ggtcaccacg gtggctccgg cacgggaatg gagcacatga
      481 tgcccatggc gttccacttt ggctacaacg agacgatcct cttctcctgg tggcacatcg
      541 aaacggtggc cggtttggtg ggctccatga tcgccatctt cctgctggcc ctgatgtacg
      601 agggcctcaa gtactatcgg gagtatctgt tctggaagac gtacaatctg ctggagtatc
      661 gcccggtgac ggggccccag aggaacccgg aggcgccgcg gattccctcg ccggcggcag
      721 cggctccctc gcccgtgcaa ccttcgatgc tgtcggttaa ccacctgctc cagacgctgc
      781 tgcacgtgct ccaggtgacc ctgtccttcc tgctcatgct gatcttcatg acctacaacg
      841 tgtggctctg cctgatggtc gtcctgggcg ccgccgtggg ctacttcctc ttctgctgga
      901 agaagtcggt aatcgtggac gtcaccgagc actgtcacta acagaggacc gccggaagcc
      961 tcagccggcg atgtctcacg gcggaggagg cggaggcaga ggagcagctg tccatctgaa
     1021 cggaaggcgg aggcgttggt gctaggctta ccaccggaat caccggaagc tcgcggcccc
     1081 acagaaaacc ccacacactt caacacacac cccctgccac ttgctattct ctataactac
     1141 tcctaaactc tttaagattt tgtaagtcga aagtgtaaag tacgcaagag agaacaaatt
     1201 gagcgactgg cgagcgaatt gtataaagtt aagcaatgtt agtactcaat ctatgtcgca
     1261 ggattccccg aaaagcaaat actttttttt tatcattatt attatacacc attttgtatc
     1321 cctattatac gatcatgatt attattattt ggtaaataaa atccaacctc ttttata