Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_070218185 1154 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_070218185 VERSION XM_070218185.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1154 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1154 /gene="Or13a" /note="Odorant receptor 13a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056068" CDS 222..1088 /gene="Or13a" /codon_start=1 /product="odorant receptor 13a isoform X1" /protein_id="XP_070074286.1" /db_xref="GeneID:108056068" /translation="MITFSIMTALLSCLIIMYCVLPLVEIFFGPELEPQDKPFPYKMV FPYNPHRSWISYALTYVFTSYAGICVVTTLFAEDTILGFFITYTCGQFQLLHERINKL FKGIHNTELAEELQLERLKRIVEKHNNIIRFAKRLEDFFNPILLANLMISSVLICMVG FQIITGKNMFIGDYVKFIIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSN RIESLSYKPTSKRVRNHIWFMILCSQQPVRITAFKFSTLSLQSFTAILSTSISYFTLL RSVYFDDEKKQD" misc_feature <240..1028 /gene="Or13a" /note="7tm Odorant receptor; Region: 7tm_6; pfam02949" /db_xref="CDD:251636" ORIGIN 1 ccgccataga aggggtgaat gacgaacgtc tcgttgccga tgtgaatgac gccacttaca 61 ccgttgcagg tgtggaaagc tgcgctggca ccaggataat ccttcacggt cccatggtag 121 taacagtgct cgatatccta taatatgaag gacataaagg aaatgatggt ttagcaagca 181 gcagttccaa aaacaatatt gctgcgtggt gtcgcaggcg catgataacc tttagcataa 241 tgacagctct gctgtcgtgc ttgatcatca tgtactgcgt cttgccgttg gttgagatat 301 tttttggtcc cgaactcgag ccccaggata agccatttcc ctacaaaatg gtctttccct 361 acaatcccca cagaagttgg atcagctatg cactcaccta cgtgttcacc tcgtatgcag 421 gaatctgtgt ggtgaccact ttgtttgcag aggacaccat tttaggattc ttcatcacct 481 acacttgcgg ccaatttcaa ttgttacacg aacgaatcaa caaattattc aagggaatac 541 ataatacgga attggcagaa gagcttcagc tggagcgtct taaacggatt gtagaaaagc 601 acaacaatat tatcagattc gctaaacgct tggaggactt ttttaatcca attctattgg 661 ccaatcttat gatttcatcg gttctaattt gcatggttgg ctttcaaata ataactggaa 721 agaacatgtt tattggggac tacgtgaagt tcatcatcta tatatcctcg gccctttcgc 781 aattatacgt actctgcgag aatggagatg ctctaataaa acagtccacg ctgacagcgc 841 aaattctata tgaatgccaa tgggagggtt caaatcgaat cgagtccctt tcgtataaac 901 caaccagcaa acgagtccga aatcatatat ggttcatgat actctgcagc cagcagcccg 961 tgaggataac agcgttcaag ttctcaactc tgtccttgca aagttttacg gcgattttga 1021 gcacgtcaat aagctatttt accctactgc ggtcggttta cttcgatgac gaaaagaaac 1081 aggactagaa atatacctaa tcacaataaa gtagtgaaaa atgtattaaa ttatcaatag 1141 ttgtattaaa aaat