PREDICTED: Stomoxys calcitrans elongation of very long chain fatty

LOCUS       XM_059368381             695 bp    mRNA    linear   INV 02-SEP-2023
            acids protein 4-like (LOC106090812), mRNA.
ACCESSION   XM_059368381
VERSION     XM_059368381.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..695
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..695
                     /gene="LOC106090812"
                     /note="elongation of very long chain fatty acids protein
                     4-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins"
                     /db_xref="GeneID:106090812"
     CDS             94..681
                     /gene="LOC106090812"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein 4-like"
                     /protein_id="XP_059224364.1"
                     /db_xref="GeneID:106090812"
                     /translation="MALLNFHILKEVVVNASQLNYNYLCQPCRVIYSKHEIKLAAAVW
                     WFYFSKLLEFSDTLFFILRHKWKQLTPLHIYHHSTMFPLWWIAIKWLPTGSTFIPVLI
                     NSFVHVIMYTYYGLSACGPAVQKYLWWKKYLTAIQLVQFTTGLLWALQAILAKCDFPL
                     AINCATMVYMISFLILFGKFFRREYQRPDKVRKIS"
ORIGIN      
        1 tgaaataatt attgaacaaa aaaatgagaa aaatgtcatt caagatataa accacggcag
       61 ctcaaaccaa tattaattgc ctacaacaca gcaatggctc tgttaaattt tcacatttta
      121 aaagaagttg ttgtcaatgc ttctcaacta aattataatt atttgtgtca accatgtcgt
      181 gtcatttatt ccaagcatga aataaagttg gctgctgctg tgtggtggtt ttatttttca
      241 aaacttttgg aattttccga tacgttattt tttatactac gacataaatg gaaacaattg
      301 acaccgctgc atatctatca tcacagcact atgtttccgt tatggtggat tgccattaaa
      361 tggttaccaa caggatcaac ttttattcca gtcctcatca attccttcgt acatgtgatc
      421 atgtacacgt actatggact tagtgcgtgt ggacctgcag tgcaaaagta tttatggtgg
      481 aaaaaatact taacggccat tcaactggta caatttacta ctgggcttct ttgggcccta
      541 caggctatcc tggccaaatg tgattttcca ttagcgatta attgtgccac aatggtttat
      601 atgatttcgt tcctcatact ttttggaaaa ttctttagga gagaatacca aagacctgat
      661 aaagtgagaa aaatttcctg atatctttaa ttgaa