Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095173


LOCUS       XM_059368380            2112 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095173), mRNA.
ACCESSION   XM_059368380
VERSION     XM_059368380.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2112
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..2112
                     /gene="LOC106095173"
                     /note="uncharacterized LOC106095173; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106095173"
     CDS             69..2027
                     /gene="LOC106095173"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095173"
                     /protein_id="XP_059224363.1"
                     /db_xref="GeneID:106095173"
                     /translation="MRKVKTKDSLKYKFLPVANGLLRFLVRATNDAQLILTKQNDEGD
                     PKYRMVIGGILNTRSFIYHNQQESPVYSVSTPSILNGNEYREFWIIWTQFFIAIGQKG
                     SCYPFMSFRDTNLFEVNYIGIRTCNGANGIWKFEENPGTICSLGFASDLRLNSESNFV
                     CNAPRGLQVYETDGLVTVSTDSGRYKFYPISDGIFSFKIRSTHDVRLALTPEPKINYH
                     MYEIFIEAYANNRSTIRQNNDDVVIAFTRGILSEEEFHEFWIRWDDSTIAVGCGGESP
                     AFMIYADQNLFPIKFVGLRSENEAEWRIPANPFASGTDIPMDDISQLNLAAGSEGSSN
                     IQAAAAATSMPDPTGSEYSSGNQAIVSVANPVAPGQSGSAESSSLLCSAGSQHAASPN
                     ASTSANSNDPAAERPGTSTTVSAAAKSIEINPSGSSNIQASAAATSMPDPAGSEYSSG
                     NQAIVSVANPVAPGQSGSAESSSLPCSAGSQNAASPNASTSGNINNSAAERPPRPPPN
                     DPNPQVERNIWVPASHGEVPPNATVGGYDNRESLYIARARHNNELIPGKLQPSRGCCL
                     ISRCLLEHRRRHYEVLCNSDGHWETWRGVVPPNAIPGGYGTFGETLYIGRAAHLGTLT
                     PGKILNGVCFIPFFLCEVPYFVFEIFVS"
ORIGIN      
        1 gtcatttttt gagttttccg tcattcagta taaaactatt aaacaggcaa catctaataa
       61 acaacgagat gagaaaggta aagactaagg actctctaaa atacaaattc ttgccggtcg
      121 caaatggctt attaaggttt ttggttcgag caaccaatga tgcccaacta atattgacaa
      181 agcagaatga tgaaggcgat cccaagtata ggatggtcat tggtggaatc ctcaatacaa
      241 ggtctttcat atatcacaac caacaggaat ccccagttta cagtgtttcc acaccgagca
      301 ttttaaatgg caacgagtat cgtgaattct ggattatttg gacccaattt ttcattgcca
      361 ttggtcaaaa gggtagttgc tatcctttta tgtcctttag ggatacaaat ctctttgagg
      421 ttaactatat aggcatacgc acttgtaatg gggcaaacgg aatttggaaa ttcgaagaaa
      481 atcccggcac catatgttct ctgggctttg caagtgattt gcgattaaat tcagaatcaa
      541 atttcgtgtg caatgcaccg cgtggccttc aagtctatga aactgatgga ttggttacag
      601 tttccaccga ctcaggacgt tataaatttt atcctatttc cgatgggata ttctcattta
      661 aaattcgttc aactcatgat gttcgattgg cactcacccc cgagccaaag ataaattatc
      721 acatgtatga aatttttatt gaagcatacg ctaataacag atcaacaatt cgtcaaaata
      781 atgatgatgt tgtgattgct tttacccgtg gtattttgag tgaagaagaa ttccatgaat
      841 tttggattcg ctgggatgat agcaccattg ctgtgggatg tggcggggaa agtccagctt
      901 ttatgattta tgctgaccaa aatctatttc ccatcaaatt tgttggctta agatcggaaa
      961 acgaggcgga atggagaatt cctgctaatc cttttgctag tggaacggat attcccatgg
     1021 atgatatatc gcaacttaat ttggcagctg gttcagaagg atcttcaaac attcaagctg
     1081 ctgctgcagc aacatctatg ccggatccaa ctggttctga atattcatca ggtaatcaag
     1141 caatcgtttc tgttgccaac cctgttgccc cgggacaaag cggctctgca gaatcttcat
     1201 ctttgctttg ttctgctggc tcccaacatg ccgcatctcc aaatgcttcc acttctgcca
     1261 acagcaacga tcctgctgct gaaagaccag gtacctcgac taccgtatct gcagctgcaa
     1321 aatcgattga aataaatcct tcgggatctt caaacattca agcttctgct gcagcaacat
     1381 ctatgccgga tccagctggt tctgaatatt catcaggtaa tcaagcaatc gtttctgttg
     1441 ccaaccctgt tgccccggga caaagcggct ctgcagaatc ttcgtctttg ccttgttctg
     1501 ctggctccca aaatgccgca tctccaaatg cttccacttc tggcaatatc aacaattctg
     1561 ctgctgaaag accaccacga ccaccaccga atgatcccaa cccacaagtt gaacgaaata
     1621 tttgggttcc tgcaagccac ggagaagtgc ctcccaatgc tactgttggc ggctatgata
     1681 atcgcgaaag tctatatatt gctcgtgccc gccataacaa tgagcttatt ccgggcaaat
     1741 tacaaccatc acgtggttgc tgtttaattt cgaggtgtct attggagcat cgccgccgtc
     1801 actatgaagt gttgtgcaac agcgatggtc actgggaaac ctggagaggt gttgtccccc
     1861 caaatgctat tccaggaggt tatgggacat tcggtgagac attgtacatc ggccgtgcag
     1921 ctcatttggg tactctcaca cctggaaaaa ttcttaatgg cgtatgtttt attccatttt
     1981 ttttgtgcga agttccgtat tttgtttttg agatttttgt ttcttagagc atcagaaaaa
     2041 aattattgta tttcatgcat gagcgcatag tatcacaaca gttttatcca tatttaaaaa
     2101 agacaagcca tg