Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368357 508 bp mRNA linear INV 02-SEP-2023 (LOC106089875), mRNA. ACCESSION XM_059368357 VERSION XM_059368357.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..508 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..508 /gene="LOC106089875" /note="protein sisterless A-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106089875" CDS 15..503 /gene="LOC106089875" /codon_start=1 /product="protein sisterless A-like" /protein_id="XP_059224340.1" /db_xref="GeneID:106089875" /translation="MQSITSHHHQQQQQQQRQQQQQQSNLSTQYIDQVVDTEMKRVKA NCQREEEQFVEQMLLENPIVVERRSLSPVGQSTQSTLQLQQQQRQRAESCRRSRIHNK IKKAKMKFRHKFMSNKLMQSISMLKCIQKLIDQAEMQLQSQGYPQQQLEKIKELYCGG GL" ORIGIN 1 cgcaaaattt ccaaatgcaa tccatcacca gccaccacca ccaacaacaa caacaacaac 61 agaggcaaca gcagcaacaa caatcgaatt taagcactca atatattgat caagttgtgg 121 acactgaaat gaagcgtgta aaggccaatt gccaacgcga agaagagcaa tttgtggagc 181 agatgctgct agaaaatccc atagtggtgg aaagacgtag cctatctccg gttgggcaat 241 caacgcaatc aactcttcaa ctgcaacaac aacaacgaca acgtgccgaa tcgtgtcgtc 301 gctctcgcat ccacaacaaa ataaaaaagg ccaaaatgaa atttcgccat aaattcatgt 361 cgaacaaact aatgcagagc atcagtatgc tgaaatgtat acaaaagctg attgaccaag 421 cggaaatgca gctgcagagc caaggatacc cacagcaaca attggagaaa atcaaagagc 481 tgtattgcgg tggtggactt taagcagc