Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein sisterless A-like


LOCUS       XM_059368357             508 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089875), mRNA.
ACCESSION   XM_059368357
VERSION     XM_059368357.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..508
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..508
                     /gene="LOC106089875"
                     /note="protein sisterless A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106089875"
     CDS             15..503
                     /gene="LOC106089875"
                     /codon_start=1
                     /product="protein sisterless A-like"
                     /protein_id="XP_059224340.1"
                     /db_xref="GeneID:106089875"
                     /translation="MQSITSHHHQQQQQQQRQQQQQQSNLSTQYIDQVVDTEMKRVKA
                     NCQREEEQFVEQMLLENPIVVERRSLSPVGQSTQSTLQLQQQQRQRAESCRRSRIHNK
                     IKKAKMKFRHKFMSNKLMQSISMLKCIQKLIDQAEMQLQSQGYPQQQLEKIKELYCGG
                     GL"
ORIGIN      
        1 cgcaaaattt ccaaatgcaa tccatcacca gccaccacca ccaacaacaa caacaacaac
       61 agaggcaaca gcagcaacaa caatcgaatt taagcactca atatattgat caagttgtgg
      121 acactgaaat gaagcgtgta aaggccaatt gccaacgcga agaagagcaa tttgtggagc
      181 agatgctgct agaaaatccc atagtggtgg aaagacgtag cctatctccg gttgggcaat
      241 caacgcaatc aactcttcaa ctgcaacaac aacaacgaca acgtgccgaa tcgtgtcgtc
      301 gctctcgcat ccacaacaaa ataaaaaagg ccaaaatgaa atttcgccat aaattcatgt
      361 cgaacaaact aatgcagagc atcagtatgc tgaaatgtat acaaaagctg attgaccaag
      421 cggaaatgca gctgcagagc caaggatacc cacagcaaca attggagaaa atcaaagagc
      481 tgtattgcgg tggtggactt taagcagc