Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368355 632 bp mRNA linear INV 02-SEP-2023 (LOC131997391), mRNA. ACCESSION XM_059368355 VERSION XM_059368355.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..632 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..632 /gene="LOC131997391" /note="uncharacterized LOC131997391; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997391" CDS 10..570 /gene="LOC131997391" /codon_start=1 /product="uncharacterized protein LOC131997391" /protein_id="XP_059224338.1" /db_xref="GeneID:131997391" /translation="MLLLPTVVAAGSFIPQVVLHMELILFTSKGPKNSNLHQCLICRK YHPLKYCKMFLAMSVKDRRRAVRAHGYCMNCMARSHDSAGCTSPDLCQRCGHAHNTLL HLPITDRIQARPSKKCETPRNVRSNVTRQNKSVRNQNGINRRNLAECKRQRSQQKTTS SLPPTTNLRRCVQNAMMALDRLQRTL" ORIGIN 1 catgctgcaa tgctcctctt gcccacggtc gtcgcagctg gatctttcat cccacaagtg 61 gtacttcaca tggaattaat tctcttcact tcaaagggtc ctaaaaattc aaacctacac 121 cagtgtctca tctgccgtaa gtatcatccg ttgaaatact gcaaaatgtt cttggcaatg 181 agcgttaagg atcggcgtcg agctgtgcga gctcatgggt attgtatgaa ttgcatggca 241 agatcacatg attcggcagg ctgtacatca ccggacttgt gtcagcgctg cggccatgca 301 cataatacac tattgcatct tcctattaca gatcgtatac aagctagacc ttccaaaaaa 361 tgtgaaactc caagaaatgt acgctctaat gtcacaaggc aaaataaatc ggtgagaaac 421 caaaatggaa ttaacagacg gaatttagcc gagtgtaaac gacaacgatc tcaacaaaag 481 acaacctctt cacttcctcc cactacaaat ttacggcgat gtgtgcagaa tgcgatgatg 541 gcattggatc gtctgcaaag gactctttaa ggacattaga ccttctctct ttggccaata 601 ctggccaagg ggggcaggat gtttactgta ct