Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997391


LOCUS       XM_059368355             632 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997391), mRNA.
ACCESSION   XM_059368355
VERSION     XM_059368355.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..632
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..632
                     /gene="LOC131997391"
                     /note="uncharacterized LOC131997391; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997391"
     CDS             10..570
                     /gene="LOC131997391"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997391"
                     /protein_id="XP_059224338.1"
                     /db_xref="GeneID:131997391"
                     /translation="MLLLPTVVAAGSFIPQVVLHMELILFTSKGPKNSNLHQCLICRK
                     YHPLKYCKMFLAMSVKDRRRAVRAHGYCMNCMARSHDSAGCTSPDLCQRCGHAHNTLL
                     HLPITDRIQARPSKKCETPRNVRSNVTRQNKSVRNQNGINRRNLAECKRQRSQQKTTS
                     SLPPTTNLRRCVQNAMMALDRLQRTL"
ORIGIN      
        1 catgctgcaa tgctcctctt gcccacggtc gtcgcagctg gatctttcat cccacaagtg
       61 gtacttcaca tggaattaat tctcttcact tcaaagggtc ctaaaaattc aaacctacac
      121 cagtgtctca tctgccgtaa gtatcatccg ttgaaatact gcaaaatgtt cttggcaatg
      181 agcgttaagg atcggcgtcg agctgtgcga gctcatgggt attgtatgaa ttgcatggca
      241 agatcacatg attcggcagg ctgtacatca ccggacttgt gtcagcgctg cggccatgca
      301 cataatacac tattgcatct tcctattaca gatcgtatac aagctagacc ttccaaaaaa
      361 tgtgaaactc caagaaatgt acgctctaat gtcacaaggc aaaataaatc ggtgagaaac
      421 caaaatggaa ttaacagacg gaatttagcc gagtgtaaac gacaacgatc tcaacaaaag
      481 acaacctctt cacttcctcc cactacaaat ttacggcgat gtgtgcagaa tgcgatgatg
      541 gcattggatc gtctgcaaag gactctttaa ggacattaga ccttctctct ttggccaata
      601 ctggccaagg ggggcaggat gtttactgta ct