Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein


LOCUS       XM_059368353             373 bp    mRNA    linear   INV 02-SEP-2023
            28a-like (LOC131997388), mRNA.
ACCESSION   XM_059368353
VERSION     XM_059368353.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..373
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..373
                     /gene="LOC131997388"
                     /note="general odorant-binding protein 28a-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:131997388"
     CDS             39..320
                     /gene="LOC131997388"
                     /codon_start=1
                     /product="general odorant-binding protein 28a-like"
                     /protein_id="XP_059224336.1"
                     /db_xref="GeneID:131997388"
                     /translation="MNRMPSTNMAGKCLRSCIMKIYNVMDSDGKFVPTVAMLEAQRLT
                     NGNMEKMKIAEDLIHACSNIKVSENDCQAAADYDWCFREQSKLMGLPQY"
     polyA_site      373
                     /gene="LOC131997388"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgatcactt ctccaaatca gcggatgtgg aaaatattat gaacagaatg ccatctacaa
       61 atatggcagg gaaatgttta agatcctgca taatgaagat atataatgtg atggattctg
      121 atgggaagtt tgtacctaca gtggcaatgc tggaagcgca gcgtctaacc aatggtaaca
      181 tggagaaaat gaaaattgca gaggatttga tacatgcctg ttccaatata aaggtctcgg
      241 aaaacgattg tcaagctgct gctgattatg actggtgctt tagagagcag tcaaaactaa
      301 tgggtttacc acaatattga agcgatgaat cattaaaaaa ctgaaataaa aaagaaaata
      361 attaaaatcg tta