Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368353 373 bp mRNA linear INV 02-SEP-2023 28a-like (LOC131997388), mRNA. ACCESSION XM_059368353 VERSION XM_059368353.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..373 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..373 /gene="LOC131997388" /note="general odorant-binding protein 28a-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997388" CDS 39..320 /gene="LOC131997388" /codon_start=1 /product="general odorant-binding protein 28a-like" /protein_id="XP_059224336.1" /db_xref="GeneID:131997388" /translation="MNRMPSTNMAGKCLRSCIMKIYNVMDSDGKFVPTVAMLEAQRLT NGNMEKMKIAEDLIHACSNIKVSENDCQAAADYDWCFREQSKLMGLPQY" polyA_site 373 /gene="LOC131997388" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgatcactt ctccaaatca gcggatgtgg aaaatattat gaacagaatg ccatctacaa 61 atatggcagg gaaatgttta agatcctgca taatgaagat atataatgtg atggattctg 121 atgggaagtt tgtacctaca gtggcaatgc tggaagcgca gcgtctaacc aatggtaaca 181 tggagaaaat gaaaattgca gaggatttga tacatgcctg ttccaatata aaggtctcgg 241 aaaacgattg tcaagctgct gctgattatg actggtgctt tagagagcag tcaaaactaa 301 tgggtttacc acaatattga agcgatgaat cattaaaaaa ctgaaataaa aaagaaaata 361 attaaaatcg tta