Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368345 1105 bp mRNA linear INV 02-SEP-2023 (LOC131997382), mRNA. ACCESSION XM_059368345 VERSION XM_059368345.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1105 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1105 /gene="LOC131997382" /note="uncharacterized LOC131997382; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997382" CDS 71..1090 /gene="LOC131997382" /codon_start=1 /product="uncharacterized protein LOC131997382" /protein_id="XP_059224328.1" /db_xref="GeneID:131997382" /translation="MLNMEWDQHLTHICETCWRHIVEFQDFQQSVILAQKINRLNFTG QKMMDTKDFIMEQDAGDVVEPGPNKIIIQSENEIQEILTAELPPAGPYNNEESTRAIK KFEIESSGVNMAKQSELASDIPVETEASLLMHAEIPTTTISADNDCFLNSVQPITVEK YESESFIVTNGKGSLRESFNSSNILLDNQSKSVKQEFSPLRDPQILDEDSLHLMSENS CDLTKDMDEEISSDDNYMNTAGPTNNQIKQHSKRSRRGKPKDPKTIAEYECAIGQWRP VLECFVCKLQMSSFSLLQQHFKQHHPIEDCHIVCCRRKLHYHYEIKRHMNIIKHPRNF DVMNV" ORIGIN 1 gccaagccaa tcaaacccat gaactgatga caagatattt tactgccgca acattttggc 61 ctgctttcag atgttgaaca tggaatggga tcaacatcta acccatatat gtgagacctg 121 ttggcgtcat attgtggaat ttcaagattt tcaacaatca gtgatattgg cacaaaaaat 181 caatcgtttg aattttactg gacagaaaat gatggatact aaagatttta ttatggagca 241 agatgctggc gatgttgtgg agcctgggcc aaacaagatt ataattcaga gtgaaaatga 301 aattcaggaa atccttactg ctgaacttcc gcctgccggc ccttataata acgaggagtc 361 cactagagct ataaagaaat ttgagattga aagcagtggc gttaatatgg caaaacaatc 421 agaattggct agtgatatcc ccgtggagac agaagcaagc ttactaatgc atgcagaaat 481 ccccacaacc accatatcgg cagacaatga ttgttttctt aattctgtgc agcctataac 541 tgtagagaag tacgaaagtg aaagcttcat tgtaacaaat ggcaaaggat ctttgaggga 601 atcatttaac tcttcgaata ttcttttgga caatcaatcc aaaagcgtta aacaagaatt 661 tagtccactt agggacccac aaattcttga tgaagattcc cttcatttga tgtctgagaa 721 ctcttgtgat ttgactaagg acatggatga agaaataagt agtgatgaca attacatgaa 781 tacagcagga cctaccaaca atcaaatcaa gcaacattcg aagcgctcac gccgtggaaa 841 acccaaggat cctaaaacta ttgcagaata tgagtgcgca ataggccagt ggaggcctgt 901 attggaatgt ttcgtttgta agttacaaat gtccagcttt tctttgctac aacaacattt 961 caagcaacac catcccattg aagactgtca cattgtgtgc tgtcgaagaa aactacacta 1021 tcattatgaa atcaaacggc acatgaatat catcaagcac cccagaaact tcgatgtgat 1081 gaatgtttaa tttccttctc acgtc