Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997373


LOCUS       XM_059368311            1033 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997373), mRNA.
ACCESSION   XM_059368311
VERSION     XM_059368311.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1033
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1033
                     /gene="LOC131997373"
                     /note="uncharacterized LOC131997373; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997373"
     CDS             259..624
                     /gene="LOC131997373"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997373"
                     /protein_id="XP_059224294.1"
                     /db_xref="GeneID:131997373"
                     /translation="MHTNQWNLRQQGNIDYKEHSASNEDLDFFDSSDTKMLEMENILK
                     PMVNLESEVISLREARQTSIDVHRPGVHRHIFCTRTHTPTKMSFCVCNRMSLLTRRRT
                     ILCTIIGYKSKNGQIVTNK"
     polyA_site      1033
                     /gene="LOC131997373"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgaattaat tgtcgcacaa ttttatatta aatatatata tgtatatgta aatggttgtt
       61 aagttaaact tgagtctttt attgacaaca acaacaacat tggtaacccc tgcatttcac
      121 gaacgtctga aatacaattg atttcaatgt tattttattc ttggaagcag agcagcggca
      181 gaattttcaa attcaacgtc aattccatca cattttgtgc atgcatggtt ttgctatgac
      241 aaattttgtt ttttgctgat gcataccaac caatggaact tgcgacaaca aggaaacatc
      301 gattataaag aacattccgc tagcaacgag gatttggatt ttttcgactc cagtgataca
      361 aagatgttag aaatggaaaa tatcctaaaa cctatggtga atttggagag tgaagttatt
      421 tctcttcgag aagcacgaca gacttcaatt gatgtgcatc gacctggagt gcatcggcac
      481 attttctgca cacggacaca tacgccaaca aaaatgtctt tttgtgtgtg taatcgtatg
      541 tcattgttaa ccagacgccg tacaattttg tgtactatta ttgggtacaa aagtaaaaat
      601 ggtcaaattg ttacaaacaa ataagttttt gggtcactct aaccatatta aattaaataa
      661 aaaaactagc cataattccg atatttatat aacaagtgcg tgcgtgcatt tgaacgttag
      721 ccctgccaaa atctaatcgc agccgccggc aaaaatgttt ttgtgttatt ctctcgatgg
      781 attctacaaa gattacaaaa tttttatgcg tattcagcaa agacctagta tagtaaaagt
      841 ggcacagttg attttcatgc aagttggcat gtcgaatgca gcatcttaac caaatcctct
      901 tttttctcct tcgcaaatag aaaattaatt tgcaaataat tacgttaaat ttaacacata
      961 cgcccatgaa gtttgtgaaa tatacaaata aaaattttct ttatctcttg gcgccgttta
     1021 taccaagttt aaa