Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368311 1033 bp mRNA linear INV 02-SEP-2023 (LOC131997373), mRNA. ACCESSION XM_059368311 VERSION XM_059368311.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1033 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1033 /gene="LOC131997373" /note="uncharacterized LOC131997373; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997373" CDS 259..624 /gene="LOC131997373" /codon_start=1 /product="uncharacterized protein LOC131997373" /protein_id="XP_059224294.1" /db_xref="GeneID:131997373" /translation="MHTNQWNLRQQGNIDYKEHSASNEDLDFFDSSDTKMLEMENILK PMVNLESEVISLREARQTSIDVHRPGVHRHIFCTRTHTPTKMSFCVCNRMSLLTRRRT ILCTIIGYKSKNGQIVTNK" polyA_site 1033 /gene="LOC131997373" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgaattaat tgtcgcacaa ttttatatta aatatatata tgtatatgta aatggttgtt 61 aagttaaact tgagtctttt attgacaaca acaacaacat tggtaacccc tgcatttcac 121 gaacgtctga aatacaattg atttcaatgt tattttattc ttggaagcag agcagcggca 181 gaattttcaa attcaacgtc aattccatca cattttgtgc atgcatggtt ttgctatgac 241 aaattttgtt ttttgctgat gcataccaac caatggaact tgcgacaaca aggaaacatc 301 gattataaag aacattccgc tagcaacgag gatttggatt ttttcgactc cagtgataca 361 aagatgttag aaatggaaaa tatcctaaaa cctatggtga atttggagag tgaagttatt 421 tctcttcgag aagcacgaca gacttcaatt gatgtgcatc gacctggagt gcatcggcac 481 attttctgca cacggacaca tacgccaaca aaaatgtctt tttgtgtgtg taatcgtatg 541 tcattgttaa ccagacgccg tacaattttg tgtactatta ttgggtacaa aagtaaaaat 601 ggtcaaattg ttacaaacaa ataagttttt gggtcactct aaccatatta aattaaataa 661 aaaaactagc cataattccg atatttatat aacaagtgcg tgcgtgcatt tgaacgttag 721 ccctgccaaa atctaatcgc agccgccggc aaaaatgttt ttgtgttatt ctctcgatgg 781 attctacaaa gattacaaaa tttttatgcg tattcagcaa agacctagta tagtaaaagt 841 ggcacagttg attttcatgc aagttggcat gtcgaatgca gcatcttaac caaatcctct 901 tttttctcct tcgcaaatag aaaattaatt tgcaaataat tacgttaaat ttaacacata 961 cgcccatgaa gtttgtgaaa tatacaaata aaaattttct ttatctcttg gcgccgttta 1021 taccaagttt aaa