Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090699


LOCUS       XM_059368293            1014 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090699), transcript variant X2, mRNA.
ACCESSION   XM_059368293
VERSION     XM_059368293.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1014
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1014
                     /gene="LOC106090699"
                     /note="uncharacterized LOC106090699; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090699"
     CDS             238..996
                     /gene="LOC106090699"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090699"
                     /protein_id="XP_059224276.1"
                     /db_xref="GeneID:106090699"
                     /translation="MFDYKIFHTAAVWLLFISASSLNTSQAARVVTTEVPTPPPAFLV
                     DTSPPSLPDQPSIEARPPWLVGPGSPPSPVINPPNLNKSLMLQLASNTEKMGATLICL
                     ADQTNDSAVVSRLNQIFDSSSAYVKEMYRLPLSDQGKIDIGNVVALNTLVYLRGVHEK
                     CANLTNPYTPANTPAAGKNFAELGNLFQTIGTTMDCLILKIDPKIIPQVPVAVGNAFQ
                     AIANDPRTSVMDILLQHEAALASTLLKMSRICLG"
ORIGIN      
        1 gtaacatgtc ccacacttaa ctttctcaat caaaattcga aattaaaatt aaatcgaatt
       61 ttctcaagtt acgaatgcaa attagcatga tatcgaaaat tttgaatctt ggtgtgaaaa
      121 aaaggggaga aaagaaaatg gaattacata taaatgagtg gatttcttcg aaatgtcatt
      181 caaacctgat ttggagttca gagttaaaga ttttcacttc tgcaacagaa caacagaatg
      241 tttgattaca agatttttca tactgctgca gtgtggctgc tgtttatctc tgcttcatcg
      301 ctgaacactt cacaggctgc tagagtagta actacagagg tgcccacacc cccacctgca
      361 tttttggtag atacatcacc cccctcactt cccgatcagc catccataga agcccgtcca
      421 ccatggctgg ttggcccagg atcaccacct tcgcctgtta ttaaccctcc caacttaaat
      481 aagtccctta tgctgcaact tgcatcgaat accgagaaaa tgggagcaac cttaatctgc
      541 ctagccgatc agaccaatga ttctgctgtt gtaagcagat taaatcaaat ttttgattct
      601 agttcggcct atgtaaagga aatgtatcgc ctacctctaa gtgatcaggg gaagatagac
      661 attggaaatg ttgtggccct caatacttta gtttatcttc gtggcgttca cgagaagtgt
      721 gccaatctaa caaatcccta cacaccagcc aatacaccgg ctgctggcaa gaattttgca
      781 gagctgggta acctatttca aacaattggt acaactatgg attgtcttat attgaaaata
      841 gatcctaaaa tcattcctca agttcctgta gccgtcggca atgcatttca agcaatagca
      901 aatgatccaa gaacttcagt tatggatatt ttattgcaac atgaggcagc attggcatcg
      961 actttgctga agatgtccag aatttgtctg ggctagacaa gaatgaagaa ggta