Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368293 1014 bp mRNA linear INV 02-SEP-2023 (LOC106090699), transcript variant X2, mRNA. ACCESSION XM_059368293 VERSION XM_059368293.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1014 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1014 /gene="LOC106090699" /note="uncharacterized LOC106090699; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090699" CDS 238..996 /gene="LOC106090699" /codon_start=1 /product="uncharacterized protein LOC106090699" /protein_id="XP_059224276.1" /db_xref="GeneID:106090699" /translation="MFDYKIFHTAAVWLLFISASSLNTSQAARVVTTEVPTPPPAFLV DTSPPSLPDQPSIEARPPWLVGPGSPPSPVINPPNLNKSLMLQLASNTEKMGATLICL ADQTNDSAVVSRLNQIFDSSSAYVKEMYRLPLSDQGKIDIGNVVALNTLVYLRGVHEK CANLTNPYTPANTPAAGKNFAELGNLFQTIGTTMDCLILKIDPKIIPQVPVAVGNAFQ AIANDPRTSVMDILLQHEAALASTLLKMSRICLG" ORIGIN 1 gtaacatgtc ccacacttaa ctttctcaat caaaattcga aattaaaatt aaatcgaatt 61 ttctcaagtt acgaatgcaa attagcatga tatcgaaaat tttgaatctt ggtgtgaaaa 121 aaaggggaga aaagaaaatg gaattacata taaatgagtg gatttcttcg aaatgtcatt 181 caaacctgat ttggagttca gagttaaaga ttttcacttc tgcaacagaa caacagaatg 241 tttgattaca agatttttca tactgctgca gtgtggctgc tgtttatctc tgcttcatcg 301 ctgaacactt cacaggctgc tagagtagta actacagagg tgcccacacc cccacctgca 361 tttttggtag atacatcacc cccctcactt cccgatcagc catccataga agcccgtcca 421 ccatggctgg ttggcccagg atcaccacct tcgcctgtta ttaaccctcc caacttaaat 481 aagtccctta tgctgcaact tgcatcgaat accgagaaaa tgggagcaac cttaatctgc 541 ctagccgatc agaccaatga ttctgctgtt gtaagcagat taaatcaaat ttttgattct 601 agttcggcct atgtaaagga aatgtatcgc ctacctctaa gtgatcaggg gaagatagac 661 attggaaatg ttgtggccct caatacttta gtttatcttc gtggcgttca cgagaagtgt 721 gccaatctaa caaatcccta cacaccagcc aatacaccgg ctgctggcaa gaattttgca 781 gagctgggta acctatttca aacaattggt acaactatgg attgtcttat attgaaaata 841 gatcctaaaa tcattcctca agttcctgta gccgtcggca atgcatttca agcaatagca 901 aatgatccaa gaacttcagt tatggatatt ttattgcaac atgaggcagc attggcatcg 961 actttgctga agatgtccag aatttgtctg ggctagacaa gaatgaagaa ggta