Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368289 836 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_059368289 VERSION XM_059368289.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..836 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..836 /gene="LOC106083230" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106083230" CDS 252..791 /gene="LOC106083230" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_059224272.1" /db_xref="GeneID:106083230" /translation="MAGSLFNFKWVVILLAIIKVTKGTPHDKWQKVDEAGKIFIEQEQ KFTWFEANNECAIRNMTLIAVDTFEKNQVIDSLLRKKFPVSPNLWIGGSDLGQEGKFI WSSTGKSFEFTNWQHQQPDNSKNDEHCVHYRINSDFEWNDAQCWGKMGFICEENRFLM EARRDLEIKKNFIEQLFSL" polyA_site 836 /gene="LOC106083230" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gataattttc tcatttcaaa atttattttg taaacaagtc attgtttgcc aatggtgctt 61 tagagctgtt gaaaaaagcg ttgataaagc caattatgct cgagactgta atgcgtgttg 121 gggtgttgtt ttggcatctg tgttttatcc aatgggaatt tccaaaccga taagaccaaa 181 cggatatgta gatataaaaa caacacaatt tcgaggaaac atcttcattc gtctcataac 241 aatcgttcaa aatggctggc agcttattca actttaaatg ggtagtaatt cttttggcta 301 ttataaaagt gaccaaaggt acgcctcatg ataaatggca gaaagtggat gaagctggca 361 aaatattcat agagcaggaa caaaagttta cttggttcga agccaacaat gaatgtgcca 421 tacgaaatat gaccttaatt gctgtggata catttgagaa aaatcaagtc atcgattcat 481 tgttaaggaa aaaatttcct gtttctccaa atttatggat tggtggcagt gaccttggtc 541 aagagggcaa gttcatatgg tcttccacag gcaaaagttt cgagttcaca aactggcaac 601 accagcaacc tgataatagt aaaaatgatg aacattgcgt ccattatcgt atcaattccg 661 actttgaatg gaatgatgca cagtgctggg gtaaaatggg ctttatttgt gaggaaaatc 721 gtttcttgat ggaagcccgc cgagatttgg aaattaagaa aaatttcata gaacaattgt 781 tttcattgta actttttgga aaacaaatta aataaaggac aacatttttt attatt