Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106083230),


LOCUS       XM_059368289             836 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_059368289
VERSION     XM_059368289.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..836
                     /gene="LOC106083230"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083230"
     CDS             252..791
                     /gene="LOC106083230"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_059224272.1"
                     /db_xref="GeneID:106083230"
                     /translation="MAGSLFNFKWVVILLAIIKVTKGTPHDKWQKVDEAGKIFIEQEQ
                     KFTWFEANNECAIRNMTLIAVDTFEKNQVIDSLLRKKFPVSPNLWIGGSDLGQEGKFI
                     WSSTGKSFEFTNWQHQQPDNSKNDEHCVHYRINSDFEWNDAQCWGKMGFICEENRFLM
                     EARRDLEIKKNFIEQLFSL"
     polyA_site      836
                     /gene="LOC106083230"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gataattttc tcatttcaaa atttattttg taaacaagtc attgtttgcc aatggtgctt
       61 tagagctgtt gaaaaaagcg ttgataaagc caattatgct cgagactgta atgcgtgttg
      121 gggtgttgtt ttggcatctg tgttttatcc aatgggaatt tccaaaccga taagaccaaa
      181 cggatatgta gatataaaaa caacacaatt tcgaggaaac atcttcattc gtctcataac
      241 aatcgttcaa aatggctggc agcttattca actttaaatg ggtagtaatt cttttggcta
      301 ttataaaagt gaccaaaggt acgcctcatg ataaatggca gaaagtggat gaagctggca
      361 aaatattcat agagcaggaa caaaagttta cttggttcga agccaacaat gaatgtgcca
      421 tacgaaatat gaccttaatt gctgtggata catttgagaa aaatcaagtc atcgattcat
      481 tgttaaggaa aaaatttcct gtttctccaa atttatggat tggtggcagt gaccttggtc
      541 aagagggcaa gttcatatgg tcttccacag gcaaaagttt cgagttcaca aactggcaac
      601 accagcaacc tgataatagt aaaaatgatg aacattgcgt ccattatcgt atcaattccg
      661 actttgaatg gaatgatgca cagtgctggg gtaaaatggg ctttatttgt gaggaaaatc
      721 gtttcttgat ggaagcccgc cgagatttgg aaattaagaa aaatttcata gaacaattgt
      781 tttcattgta actttttgga aaacaaatta aataaaggac aacatttttt attatt