Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368272 951 bp mRNA linear INV 02-SEP-2023 protein 1 (LOC106086008), transcript variant X2, mRNA. ACCESSION XM_059368272 VERSION XM_059368272.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..951 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..951 /gene="LOC106086008" /note="fibrinogen C domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106086008" CDS 41..874 /gene="LOC106086008" /codon_start=1 /product="fibrinogen C domain-containing protein 1 isoform X2" /protein_id="XP_059224255.1" /db_xref="GeneID:106086008" /translation="MKCTLNIFLVVWCLGCAISTNSTNSKDYLDLYNGDDQIIIIQSL FMKINSLLIEINNTNQRLGDMEKRLVTQNSQIRNLHQAVDLQKNQLTESQTEINKRLG ELSEGNAWITILKRFDGSVDFYRSWQEYKDGFGKPPNGEFFIGLTKLYRMTSAAPYEL LIELRDWDDEMRYAHYDHFKIGSEREKYKLKILGSYSGDAKDALSRHRRENFATFDED SDQCAHEYRGAWWFYNCYSSHLFGPYRNSNVENPGMSWDKWRNDYSLKTAEMKIRKKS L" ORIGIN 1 ctcaaaggca ctgcagttgt ccgtagattt ttgcagacaa atgaagtgca ccttaaacat 61 ttttctggtg gtctggtgtc taggatgtgc tatcagcaca aattccacca acagcaagga 121 ttatctggat ttgtataatg gtgatgacca aataatcatt atacagtcgc tcttcatgaa 181 aatcaattcc ctattgatag aaatcaataa tacaaatcaa aggctgggag acatggaaaa 241 gagacttgtg acgcaaaatt cccagataag gaatttgcat caagctgtag atttgcagaa 301 aaaccaattg accgaaagcc aaactgagat caataaaaga ttaggcgagt tgtcagaggg 361 taatgcctgg attactatcc tcaaacgttt tgatggttct gttgactttt atcgctcttg 421 gcaagaatac aaagacgggt ttggtaaacc ccccaatggg gaatttttta ttggtctgac 481 caaactctat cgtatgacct cggcagctcc ctatgaactt ttaatagagc tacgcgattg 541 ggatgatgaa atgcgttatg cccactatga tcattttaag attggaagtg aaagagaaaa 601 atataagctc aagatattgg gtagctattc aggagatgca aaagatgcct tgtcgcgtca 661 tagaagagag aactttgcta cctttgacga ggacagtgat caatgtgctc atgagtacag 721 gggagcatgg tggttttaca actgctacag cagccatttg tttggcccct atagaaacag 781 taatgttgaa aatcctggca tgagttggga taaatggaga aacgattatt ccttgaaaac 841 tgccgaaatg aaaattcgta aaaaaagttt gtgacaaaac tggcttcaat aaaaaagcag 901 gcctaagaaa aaatattcta gccagaaaaa taaaataaac cgaaaaacac a