Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_059368272             951 bp    mRNA    linear   INV 02-SEP-2023
            protein 1 (LOC106086008), transcript variant X2, mRNA.
ACCESSION   XM_059368272
VERSION     XM_059368272.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..951
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..951
                     /gene="LOC106086008"
                     /note="fibrinogen C domain-containing protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106086008"
     CDS             41..874
                     /gene="LOC106086008"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1 isoform
                     X2"
                     /protein_id="XP_059224255.1"
                     /db_xref="GeneID:106086008"
                     /translation="MKCTLNIFLVVWCLGCAISTNSTNSKDYLDLYNGDDQIIIIQSL
                     FMKINSLLIEINNTNQRLGDMEKRLVTQNSQIRNLHQAVDLQKNQLTESQTEINKRLG
                     ELSEGNAWITILKRFDGSVDFYRSWQEYKDGFGKPPNGEFFIGLTKLYRMTSAAPYEL
                     LIELRDWDDEMRYAHYDHFKIGSEREKYKLKILGSYSGDAKDALSRHRRENFATFDED
                     SDQCAHEYRGAWWFYNCYSSHLFGPYRNSNVENPGMSWDKWRNDYSLKTAEMKIRKKS
                     L"
ORIGIN      
        1 ctcaaaggca ctgcagttgt ccgtagattt ttgcagacaa atgaagtgca ccttaaacat
       61 ttttctggtg gtctggtgtc taggatgtgc tatcagcaca aattccacca acagcaagga
      121 ttatctggat ttgtataatg gtgatgacca aataatcatt atacagtcgc tcttcatgaa
      181 aatcaattcc ctattgatag aaatcaataa tacaaatcaa aggctgggag acatggaaaa
      241 gagacttgtg acgcaaaatt cccagataag gaatttgcat caagctgtag atttgcagaa
      301 aaaccaattg accgaaagcc aaactgagat caataaaaga ttaggcgagt tgtcagaggg
      361 taatgcctgg attactatcc tcaaacgttt tgatggttct gttgactttt atcgctcttg
      421 gcaagaatac aaagacgggt ttggtaaacc ccccaatggg gaatttttta ttggtctgac
      481 caaactctat cgtatgacct cggcagctcc ctatgaactt ttaatagagc tacgcgattg
      541 ggatgatgaa atgcgttatg cccactatga tcattttaag attggaagtg aaagagaaaa
      601 atataagctc aagatattgg gtagctattc aggagatgca aaagatgcct tgtcgcgtca
      661 tagaagagag aactttgcta cctttgacga ggacagtgat caatgtgctc atgagtacag
      721 gggagcatgg tggttttaca actgctacag cagccatttg tttggcccct atagaaacag
      781 taatgttgaa aatcctggca tgagttggga taaatggaga aacgattatt ccttgaaaac
      841 tgccgaaatg aaaattcgta aaaaaagttt gtgacaaaac tggcttcaat aaaaaagcag
      901 gcctaagaaa aaatattcta gccagaaaaa taaaataaac cgaaaaacac a