Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368271 972 bp mRNA linear INV 02-SEP-2023 protein 1 (LOC106086008), transcript variant X1, mRNA. ACCESSION XM_059368271 VERSION XM_059368271.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..972 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..972 /gene="LOC106086008" /note="fibrinogen C domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106086008" CDS 41..895 /gene="LOC106086008" /codon_start=1 /product="fibrinogen C domain-containing protein 1 isoform X1" /protein_id="XP_059224254.1" /db_xref="GeneID:106086008" /translation="MKCTLNIFLVVWCLGCAISTNSTNSKDYLDLYNGDDQIIIIQSL FMKINSLLIEINNTNQRLGDMEKRISEINERLVTQNSQIRNLHQAVDLQKNQLTESQT EINKRLGELSEGNAWITILKRFDGSVDFYRSWQEYKDGFGKPPNGEFFIGLTKLYRMT SAAPYELLIELRDWDDEMRYAHYDHFKIGSEREKYKLKILGSYSGDAKDALSRHRREN FATFDEDSDQCAHEYRGAWWFYNCYSSHLFGPYRNSNVENPGMSWDKWRNDYSLKTAE MKIRKKSL" ORIGIN 1 ctcaaaggca ctgcagttgt ccgtagattt ttgcagacaa atgaagtgca ccttaaacat 61 ttttctggtg gtctggtgtc taggatgtgc tatcagcaca aattccacca acagcaagga 121 ttatctggat ttgtataatg gtgatgacca aataatcatt atacagtcgc tcttcatgaa 181 aatcaattcc ctattgatag aaatcaataa tacaaatcaa aggctgggag acatggaaaa 241 gagaatcagc gaaatcaatg aaagacttgt gacgcaaaat tcccagataa ggaatttgca 301 tcaagctgta gatttgcaga aaaaccaatt gaccgaaagc caaactgaga tcaataaaag 361 attaggcgag ttgtcagagg gtaatgcctg gattactatc ctcaaacgtt ttgatggttc 421 tgttgacttt tatcgctctt ggcaagaata caaagacggg tttggtaaac cccccaatgg 481 ggaatttttt attggtctga ccaaactcta tcgtatgacc tcggcagctc cctatgaact 541 tttaatagag ctacgcgatt gggatgatga aatgcgttat gcccactatg atcattttaa 601 gattggaagt gaaagagaaa aatataagct caagatattg ggtagctatt caggagatgc 661 aaaagatgcc ttgtcgcgtc atagaagaga gaactttgct acctttgacg aggacagtga 721 tcaatgtgct catgagtaca ggggagcatg gtggttttac aactgctaca gcagccattt 781 gtttggcccc tatagaaaca gtaatgttga aaatcctggc atgagttggg ataaatggag 841 aaacgattat tccttgaaaa ctgccgaaat gaaaattcgt aaaaaaagtt tgtgacaaaa 901 ctggcttcaa taaaaaagca ggcctaagaa aaaatattct agccagaaaa ataaaataaa 961 ccgaaaaaca ca