Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing


LOCUS       XM_059368271             972 bp    mRNA    linear   INV 02-SEP-2023
            protein 1 (LOC106086008), transcript variant X1, mRNA.
ACCESSION   XM_059368271
VERSION     XM_059368271.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..972
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..972
                     /gene="LOC106086008"
                     /note="fibrinogen C domain-containing protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106086008"
     CDS             41..895
                     /gene="LOC106086008"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1 isoform
                     X1"
                     /protein_id="XP_059224254.1"
                     /db_xref="GeneID:106086008"
                     /translation="MKCTLNIFLVVWCLGCAISTNSTNSKDYLDLYNGDDQIIIIQSL
                     FMKINSLLIEINNTNQRLGDMEKRISEINERLVTQNSQIRNLHQAVDLQKNQLTESQT
                     EINKRLGELSEGNAWITILKRFDGSVDFYRSWQEYKDGFGKPPNGEFFIGLTKLYRMT
                     SAAPYELLIELRDWDDEMRYAHYDHFKIGSEREKYKLKILGSYSGDAKDALSRHRREN
                     FATFDEDSDQCAHEYRGAWWFYNCYSSHLFGPYRNSNVENPGMSWDKWRNDYSLKTAE
                     MKIRKKSL"
ORIGIN      
        1 ctcaaaggca ctgcagttgt ccgtagattt ttgcagacaa atgaagtgca ccttaaacat
       61 ttttctggtg gtctggtgtc taggatgtgc tatcagcaca aattccacca acagcaagga
      121 ttatctggat ttgtataatg gtgatgacca aataatcatt atacagtcgc tcttcatgaa
      181 aatcaattcc ctattgatag aaatcaataa tacaaatcaa aggctgggag acatggaaaa
      241 gagaatcagc gaaatcaatg aaagacttgt gacgcaaaat tcccagataa ggaatttgca
      301 tcaagctgta gatttgcaga aaaaccaatt gaccgaaagc caaactgaga tcaataaaag
      361 attaggcgag ttgtcagagg gtaatgcctg gattactatc ctcaaacgtt ttgatggttc
      421 tgttgacttt tatcgctctt ggcaagaata caaagacggg tttggtaaac cccccaatgg
      481 ggaatttttt attggtctga ccaaactcta tcgtatgacc tcggcagctc cctatgaact
      541 tttaatagag ctacgcgatt gggatgatga aatgcgttat gcccactatg atcattttaa
      601 gattggaagt gaaagagaaa aatataagct caagatattg ggtagctatt caggagatgc
      661 aaaagatgcc ttgtcgcgtc atagaagaga gaactttgct acctttgacg aggacagtga
      721 tcaatgtgct catgagtaca ggggagcatg gtggttttac aactgctaca gcagccattt
      781 gtttggcccc tatagaaaca gtaatgttga aaatcctggc atgagttggg ataaatggag
      841 aaacgattat tccttgaaaa ctgccgaaat gaaaattcgt aaaaaaagtt tgtgacaaaa
      901 ctggcttcaa taaaaaagca ggcctaagaa aaaatattct agccagaaaa ataaaataaa
      961 ccgaaaaaca ca