Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368184 933 bp mRNA linear INV 02-SEP-2023 (LOC131997336), mRNA. ACCESSION XM_059368184 VERSION XM_059368184.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..933 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..933 /gene="LOC131997336" /note="uncharacterized LOC131997336; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997336" CDS 48..650 /gene="LOC131997336" /codon_start=1 /product="uncharacterized protein LOC131997336" /protein_id="XP_059224167.1" /db_xref="GeneID:131997336" /translation="MQQNQKYDISNNQIIKRKFKMRVRDIYTCMLCKMRHSLRYCPKF VMMSVSDRRIVIRKFKYCINCLARSHTIEKCHSEETCRKCRYQHHTMLHPKPTREPKS ERSTEVSINLRSRLGQQSQKVNKTSPQGQQRSTTLRKTKQQHSKVQKTAKRYPKTRKN NLPNIMQPDPMLLSEAIKSLASVLCASSVAQVQGRRHGQN" polyA_site 933 /gene="LOC131997336" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtgaatagtg tgaaaatcta ttttgaacag aaaacagttt aggctgaatg caacaaaatc 61 aaaaatatga catttccaac aaccagatca tcaaaagaaa gttcaaaatg cgcgtacgtg 121 atatatacac ctgcatgttg tgcaagatgc gtcactcctt acggtactgc cctaaatttg 181 taatgatgag tgtgtcagac agaaggatcg ttatccgcaa atttaaatac tgcatcaatt 241 gtcttgcgag gagccacacg atagaaaaat gccattccga ggaaacgtgc cgcaagtgca 301 ggtatcaaca tcatactatg ctgcatccga agcctactcg agagcctaaa tccgagagga 361 gcacagaagt cagcataaat ctccgttcta gactgggtca gcagtcacaa aaagtcaata 421 aaacgtcgcc tcaaggtcaa caacgatcta caaccttaag aaagaccaaa caacaacaca 481 gcaaggtaca aaagacggcc aaacgatacc ccaagacaag aaaaaataat ttacccaata 541 ttatgcaacc agatccgatg cttctttctg aggccataaa gtctttggcg tccgtgcttt 601 gtgcatcttc tgttgcacaa gtgcaaggcc ggcgccatgg acaaaattga agttttgtcc 661 ttaactattt acatgaattt gaactattta aatgaaattg aatttcctaa cgtctgttat 721 tgtgaattat ctaagagatg tatttaaatt tccctaccac atatgctaag tggtaataga 781 ataggcactt agtttgtaag tactaaaata tctccctttc gtatgtgaag ttacacttgc 841 ttcacttctg gcacaaccac gaaaaggtga gcatctcttc tcttctctac ttttttatta 901 ctttaaataa aatttataac gttgaaagtt gaa