Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans CTD nuclear envelope phosphatase 1


LOCUS       XM_059368172            1360 bp    mRNA    linear   INV 02-SEP-2023
            homolog (LOC106095345), transcript variant X2, mRNA.
ACCESSION   XM_059368172
VERSION     XM_059368172.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1360
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1360
                     /gene="LOC106095345"
                     /note="CTD nuclear envelope phosphatase 1 homolog; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins"
                     /db_xref="GeneID:106095345"
     CDS             449..1180
                     /gene="LOC106095345"
                     /codon_start=1
                     /product="CTD nuclear envelope phosphatase 1 homolog
                     isoform X1"
                     /protein_id="XP_059224155.1"
                     /db_xref="GeneID:106095345"
                     /translation="MFSLVQMKFRALLVLLSKIWTCICFMFNRQVRAFVQYQPVKYEL
                     FPLSPVSRHRLSIVQRKTLVLDLDETLIHSHHNAMPRNIVKPGTPHDFTVKVTIDRHP
                     VRFFVHKRPHVDFFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHC
                     TPDYGSYTKDLSAICNDLNRIFIIDNSPAAYRCFPHNAIPIKSWFSDPMDISLLSLLP
                     MLDALRFTNDVRSVLSRNLHLHGLW"
     polyA_site      1360
                     /gene="LOC106095345"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattgttgtt ggacagtata attgacagta aaattgttta gtgtgccctg gtatttcgct
       61 tgtgtagtga atcgtagagt tataaataaa taataaatga ttaaatgcac ggcaagtgcc
      121 cacatacaat tcagataaac aataaataca tagaagtgaa aaatttattt tggaataagc
      181 tttgttaaaa gcaaaaacga tccaacaatt aagtgccgtc gcgtgtaaac aacaacaaca
      241 aaaatagcaa acaatcatca ggcatttgaa acaagcaata agcacccgcc tcctcttagg
      301 tgaaagatag attggtcatt tgttttaaac agatactata ttttgagaat aggttttggt
      361 taaaaaaaaa gtatatacat acatatatat acatagaaat atacataaac atttatgtag
      421 tgttcattgg taagtttctt tcttaccaat gttttccctc gttcaaatga aattccgtgc
      481 tttactggta ctactatcaa aaatatggac gtgcatatgt tttatgttca atcgtcaagt
      541 aagagcattt gtccagtatc aacctgtcaa atatgaacta tttccactgt cccctgtgtc
      601 gcgacaccgc ctcagcattg tacaacggaa gactttggtt ttggatttgg atgaaacatt
      661 aatacattcg catcacaatg ctatgcccag gaatattgtt aaacccggaa cacctcatga
      721 ttttacagtc aaagtaacaa tagatagaca tccggtgaga ttttttgtac ataaaagacc
      781 acatgtcgat ttcttcctag acgtggtttc gcaatggtat gacttggtgg ttttcacagc
      841 cagtatggag atttatggcg ctgctgttgc tgacaaatta gacaatggcc gtaatatatt
      901 gagacggcgc tattatcgac aacattgcac accagattat ggttcatata ccaaagattt
      961 atcagctatt tgtaatgact taaatagaat attcataatt gacaactcgc cagctgcata
     1021 tcgttgtttt cctcataatg ctatacccat aaaaagttgg ttttccgacc caatggatat
     1081 ttcattattg tcgttacttc caatgttgga tgctttaagg tttacaaatg atgtccgttc
     1141 agttttgtcg agaaatttac atctgcatgg cctatggtag caggttaaca aattaaaaat
     1201 ttggtgctgt gacacttgaa cgaatttttg tttgtttcat taatttaaat taattttttc
     1261 tattatataa gaaattacta aaaatcatgt gaagataaaa cagatttgtt aatggcaaga
     1321 catattacat taaataaata aaaaacaatt tcttgacttg