Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368172 1360 bp mRNA linear INV 02-SEP-2023 homolog (LOC106095345), transcript variant X2, mRNA. ACCESSION XM_059368172 VERSION XM_059368172.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1360 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1360 /gene="LOC106095345" /note="CTD nuclear envelope phosphatase 1 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106095345" CDS 449..1180 /gene="LOC106095345" /codon_start=1 /product="CTD nuclear envelope phosphatase 1 homolog isoform X1" /protein_id="XP_059224155.1" /db_xref="GeneID:106095345" /translation="MFSLVQMKFRALLVLLSKIWTCICFMFNRQVRAFVQYQPVKYEL FPLSPVSRHRLSIVQRKTLVLDLDETLIHSHHNAMPRNIVKPGTPHDFTVKVTIDRHP VRFFVHKRPHVDFFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHC TPDYGSYTKDLSAICNDLNRIFIIDNSPAAYRCFPHNAIPIKSWFSDPMDISLLSLLP MLDALRFTNDVRSVLSRNLHLHGLW" polyA_site 1360 /gene="LOC106095345" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattgttgtt ggacagtata attgacagta aaattgttta gtgtgccctg gtatttcgct 61 tgtgtagtga atcgtagagt tataaataaa taataaatga ttaaatgcac ggcaagtgcc 121 cacatacaat tcagataaac aataaataca tagaagtgaa aaatttattt tggaataagc 181 tttgttaaaa gcaaaaacga tccaacaatt aagtgccgtc gcgtgtaaac aacaacaaca 241 aaaatagcaa acaatcatca ggcatttgaa acaagcaata agcacccgcc tcctcttagg 301 tgaaagatag attggtcatt tgttttaaac agatactata ttttgagaat aggttttggt 361 taaaaaaaaa gtatatacat acatatatat acatagaaat atacataaac atttatgtag 421 tgttcattgg taagtttctt tcttaccaat gttttccctc gttcaaatga aattccgtgc 481 tttactggta ctactatcaa aaatatggac gtgcatatgt tttatgttca atcgtcaagt 541 aagagcattt gtccagtatc aacctgtcaa atatgaacta tttccactgt cccctgtgtc 601 gcgacaccgc ctcagcattg tacaacggaa gactttggtt ttggatttgg atgaaacatt 661 aatacattcg catcacaatg ctatgcccag gaatattgtt aaacccggaa cacctcatga 721 ttttacagtc aaagtaacaa tagatagaca tccggtgaga ttttttgtac ataaaagacc 781 acatgtcgat ttcttcctag acgtggtttc gcaatggtat gacttggtgg ttttcacagc 841 cagtatggag atttatggcg ctgctgttgc tgacaaatta gacaatggcc gtaatatatt 901 gagacggcgc tattatcgac aacattgcac accagattat ggttcatata ccaaagattt 961 atcagctatt tgtaatgact taaatagaat attcataatt gacaactcgc cagctgcata 1021 tcgttgtttt cctcataatg ctatacccat aaaaagttgg ttttccgacc caatggatat 1081 ttcattattg tcgttacttc caatgttgga tgctttaagg tttacaaatg atgtccgttc 1141 agttttgtcg agaaatttac atctgcatgg cctatggtag caggttaaca aattaaaaat 1201 ttggtgctgt gacacttgaa cgaatttttg tttgtttcat taatttaaat taattttttc 1261 tattatataa gaaattacta aaaatcatgt gaagataaaa cagatttgtt aatggcaaga 1321 catattacat taaataaata aaaaacaatt tcttgacttg