Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans achaete-scute complex protein T3


LOCUS       XM_059368164             780 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997329), mRNA.
ACCESSION   XM_059368164
VERSION     XM_059368164.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..780
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..780
                     /gene="LOC131997329"
                     /note="achaete-scute complex protein T3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:131997329"
     CDS             1..780
                     /gene="LOC131997329"
                     /codon_start=1
                     /product="achaete-scute complex protein T3"
                     /protein_id="XP_059224147.1"
                     /db_xref="GeneID:131997329"
                     /translation="MASVCMTQSNFQQPQHHFQIINGNMMMLPQQANGHHHMQYVNKL
                     QPIAPAQPKVLGTSNLQNIQQNSAVGPMMEKKRFTYNAMPYGEQLPSVARRNARERNR
                     VKQVNNGFSNLRQHIPQSVINALSSGGRGASKKLSKVDTLRIAVEYIRGLQDLLDSSE
                     GGSVNSSKVPTSSFNYDDSSNDGSNYGYSSMDSPVDNHTYQMTHSPTSSYSDSDVSIN
                     AANSFVTPLKLEEPDHDFKFESFEQGDDEELLDYISSWQDQ"
ORIGIN      
        1 atggccagcg tttgcatgac ccaaagcaac tttcaacaac ctcaacatca tttccaaatc
       61 atcaacggca acatgatgat gttgcctcaa caggccaatg gccatcacca catgcaatat
      121 gtgaataaat tgcagcccat tgctcctgca caacccaaag tcttgggaac cagcaatttg
      181 cagaacatac aacagaactc tgctgtgggc cccatgatgg aaaagaagcg tttcacctac
      241 aacgccatgc cctatggtga gcaattgccc tcggtggctc gtcgcaatgc acgtgagcgt
      301 aatcgtgtca agcaagtcaa caatggtttc tccaatctgc gccaacacat cccccaatcg
      361 gtgatcaatg ccttgtcctc gggcggccgt ggggccagca agaaactctc caaagtcgat
      421 actctacgca ttgctgttga atacattcgt ggcttgcaag atctcttgga ttcatcagag
      481 ggtggctcgg tcaacagcag caaagtgccc accagctcct ttaactacga cgactccagc
      541 aatgatggca gcaactatgg ttactcctcc atggacagtc ctgtggacaa tcatacctac
      601 caaatgacgc actctcccac ctcctcttat tcggattctg atgtgtccat caatgccgcc
      661 aacagttttg tgaccccctt gaaattggaa gaacccgatc acgacttcaa attcgaatcc
      721 ttcgagcagg gtgatgatga agagctattg gactatattt cctcatggca agatcaataa