Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368164 780 bp mRNA linear INV 02-SEP-2023 (LOC131997329), mRNA. ACCESSION XM_059368164 VERSION XM_059368164.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..780 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..780 /gene="LOC131997329" /note="achaete-scute complex protein T3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:131997329" CDS 1..780 /gene="LOC131997329" /codon_start=1 /product="achaete-scute complex protein T3" /protein_id="XP_059224147.1" /db_xref="GeneID:131997329" /translation="MASVCMTQSNFQQPQHHFQIINGNMMMLPQQANGHHHMQYVNKL QPIAPAQPKVLGTSNLQNIQQNSAVGPMMEKKRFTYNAMPYGEQLPSVARRNARERNR VKQVNNGFSNLRQHIPQSVINALSSGGRGASKKLSKVDTLRIAVEYIRGLQDLLDSSE GGSVNSSKVPTSSFNYDDSSNDGSNYGYSSMDSPVDNHTYQMTHSPTSSYSDSDVSIN AANSFVTPLKLEEPDHDFKFESFEQGDDEELLDYISSWQDQ" ORIGIN 1 atggccagcg tttgcatgac ccaaagcaac tttcaacaac ctcaacatca tttccaaatc 61 atcaacggca acatgatgat gttgcctcaa caggccaatg gccatcacca catgcaatat 121 gtgaataaat tgcagcccat tgctcctgca caacccaaag tcttgggaac cagcaatttg 181 cagaacatac aacagaactc tgctgtgggc cccatgatgg aaaagaagcg tttcacctac 241 aacgccatgc cctatggtga gcaattgccc tcggtggctc gtcgcaatgc acgtgagcgt 301 aatcgtgtca agcaagtcaa caatggtttc tccaatctgc gccaacacat cccccaatcg 361 gtgatcaatg ccttgtcctc gggcggccgt ggggccagca agaaactctc caaagtcgat 421 actctacgca ttgctgttga atacattcgt ggcttgcaag atctcttgga ttcatcagag 481 ggtggctcgg tcaacagcag caaagtgccc accagctcct ttaactacga cgactccagc 541 aatgatggca gcaactatgg ttactcctcc atggacagtc ctgtggacaa tcatacctac 601 caaatgacgc actctcccac ctcctcttat tcggattctg atgtgtccat caatgccgcc 661 aacagttttg tgaccccctt gaaattggaa gaacccgatc acgacttcaa attcgaatcc 721 ttcgagcagg gtgatgatga agagctattg gactatattt cctcatggca agatcaataa