Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368160 1178 bp mRNA linear INV 02-SEP-2023 (LOC131997327), mRNA. ACCESSION XM_059368160 VERSION XM_059368160.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1178 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1178 /gene="LOC131997327" /note="uncharacterized LOC131997327; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997327" CDS 58..906 /gene="LOC131997327" /codon_start=1 /product="uncharacterized protein LOC131997327" /protein_id="XP_059224143.1" /db_xref="GeneID:131997327" /translation="MGKSSTSSTPKCRICEERHFLKHCPKFQRMPVSERRKVIREKGF CFNCLCTAHTRSWCPSRQKCMVCQQNHHTMVHTDDKSSGTKQQNRNAHFKTKGNGRSD SALRETPVASSRQKHLNERLSRRPTMHVFLPTALARIVTSTGPKKARLLLSSGEAQTV VLKELVERLNVRTTKRDGKEYCCLNLESYHDPLIKIQIHGLVKSQFHTVLPKATNEPK LKALYDHLTDLADPHFFHPSNIEIIVANDQLSKVLRAGLIQSSSNMPLVQSTIFGWVI SGACHY" ORIGIN 1 atcacgtcca ccgctctagt ttaaaaacaa attattctat aacttccata gaagacaatg 61 ggaaaaagct caacatctag cacaccaaag tgtcgtatct gcgaggaaag acatttccta 121 aaacattgtc ccaaatttca acgtatgcct gtctcggaac gacggaaggt cataagagaa 181 aaaggctttt gtttcaattg cctatgcact gcacatacac gaagctggtg cccatccagg 241 caaaagtgca tggtatgcca acaaaatcac cacactatgg ttcataccga cgacaaatcc 301 tctggaacca aacaacaaaa tcggaatgcc cattttaaga cgaaaggaaa cggaagaagc 361 gattcagctc ttcgggaaac acctgtagcc tctagccgtc agaaacactt aaatgagcgt 421 ttgagccgac gtccaacaat gcacgttttc cttcctactg ctcttgctcg gatcgtgaca 481 tctactggtc caaaaaaagc gcgattgctg cttagctctg gagaagctca gaccgtggtt 541 ttgaaagaat tggtcgaacg ccttaatgtt cgcactacta agcgagatgg caaagagtat 601 tgctgcttaa atctggaatc gtatcatgac cctttaataa aaattcagat tcatggttta 661 gtaaaatctc aatttcacac cgtgctacca aaagccacta atgagccaaa acttaaagcg 721 ttgtatgacc atctaaccga cctggcagac ccacattttt ttcacccatc gaatattgaa 781 atcattgtgg cgaatgatca actatccaaa gttttacgag ctggcctaat ccaatcgtct 841 tccaatatgc cactagtaca gagtaccatc tttggctggg tcatctcagg tgcttgtcac 901 tactgatttt gcagtgttgc aaggcggccg gcatgttgaa gcaacttcaa caacattttt 961 gcagtcattt ttatataagt cataaacatc tttagaataa ggcaaatgaa ttatattgaa 1021 tttaaccatt tgaattttct ttaacgttaa ttaatataag attggcaacg ctttcatcct 1081 aatatgtatc gcaacgaatt gattactaac tagtacgtac taaaccccct ttttgtctct 1141 ttctaacatt atctatacgg ctgaaatact ttactaaa