Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368138 720 bp mRNA linear INV 02-SEP-2023 (LOC106091357), transcript variant X2, mRNA. ACCESSION XM_059368138 VERSION XM_059368138.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..720 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..720 /gene="LOC106091357" /note="uncharacterized LOC106091357; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106091357" CDS 30..686 /gene="LOC106091357" /codon_start=1 /product="uncharacterized protein LOC106091357 isoform X2" /protein_id="XP_059224121.1" /db_xref="GeneID:106091357" /translation="MAKKLIEAGEIHIMDISKNVDNFGHIRNHLGKLKRLQKNKEKAN KTCRIVMTKNQAFNFYKTNFQAVNNPMKVKKTKSVKISVTRKTGLDFHLYEILHDNKT GDDNPLIFAPYTWDGREIIWTNENNRRRVNDIKLWSFILTQYEKQMKYSSIYLNAKVK KYFLKILRFKLNVNFPEIDVGAIPIMKCINSMLMEALRIYRIFEEPGWDSNRDVQEPE " ORIGIN 1 tgaagcaaca ataatagtaa atcaacaaaa tggcaaaaaa attaattgag gctggtgaaa 61 tacatatcat ggacattagt aaaaatgtgg acaatttcgg tcatattaga aaccatttgg 121 gaaaattgaa acgactgcag aaaaataaag aaaaagctaa taaaacttgt agaattgtca 181 tgaccaaaaa ccaagctttt aatttttaca aaacaaattt tcaagctgtg aataatccta 241 tgaaagtgaa gaaaactaaa tcggtgaaaa taagtgtaac aaggaaaacc ggactcgatt 301 ttcatcttta cgaaatactc catgataata aaacgggaga tgataatcca ttaatttttg 361 ctccctatac ttgggatgga agggaaataa tttggacaaa tgaaaataat agacgcagag 421 taaatgacat caaactttgg agttttatac tcacacaata tgagaaacaa atgaaatatt 481 cttcaattta cctaaatgcc aaagtgaaga agtatttcct taagattcta cgttttaaat 541 tgaatgtaaa ctttccggaa attgacgttg gcgccatacc aataatgaaa tgcattaaca 601 gtatgctaat ggaagcttta cgaatctatc gaatatttga agagcccggc tgggattcga 661 atcgagatgt tcaggagcca gaatgaattc caaaaattct atcaaagaat taaacatcaa