Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cyclin-dependent kinase 10


LOCUS       XM_059368112            1236 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094391), transcript variant X2, mRNA.
ACCESSION   XM_059368112
VERSION     XM_059368112.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1236
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1236
                     /gene="LOC106094391"
                     /note="cyclin-dependent kinase 10; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106094391"
     CDS             88..1152
                     /gene="LOC106094391"
                     /codon_start=1
                     /product="cyclin-dependent kinase 10 isoform X2"
                     /protein_id="XP_059224095.1"
                     /db_xref="GeneID:106094391"
                     /translation="MCMAGVGLLLSLRNLIGLVRVHMELYRARDTRTNEIVALKKVRM
                     DQEKDGLPVSGLREITILKKCKHENIVNLRDVVVGKSLESIFLVMEYCEQDLASLLDN
                     MAQPFSESEVKCIVLQVLQGLKYMHSRYIIHRDLKVSNLLMTDKGCVKIADFGLARLF
                     GLPSGPMTPQVVTLWYRSPELLLGSPTQTTAVDMWAVGCILGELLSHKPLLPGNTEIA
                     QLELIIDLLGTPSEAIWPDYPKMPAIQNFTLKKQPYNNLKPKFQYLSAAGLRLLNFLF
                     MYDPKKRATPEECLHSTYFKEPPLPCDPKLMPTFPQHRNMQHNSTKSAPSGAHHSGPV
                     PELPAISDLLGSLLKKRRVD"
     polyA_site      1236
                     /gene="LOC106094391"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgatactga tccagttgcg ccggtaactc gtaaaggatt tttgatatcc attaaaactg
       61 gcgaaccaac agaaattaga gagcgtgatg tgcatggccg gtgtcgggct gttactgagt
      121 ttgagaaact taatcggatt ggtgagggta catatggaat tgtatcgtgc aagagatacc
      181 cgcactaatg agatagtggc tttgaaaaaa gttcgaatgg atcaagaaaa ggatggacta
      241 cccgtcagtg gattgcgaga aataacaatt ttgaaaaaat gcaaacatga aaatatagtc
      301 aacttacgag atgttgtcgt tggaaaaagt ttagaaagca tatttttggt gatggaatat
      361 tgcgaacaag acttagcatc gttattagat aacatggcac aaccattctc tgaatctgaa
      421 gtcaagtgta ttgtcctaca agttctacag ggactgaaat acatgcactc tcgttatatt
      481 atacatagag atttaaaagt ttcaaattta ttgatgaccg acaaaggatg tgtaaaaatt
      541 gccgattttg gattagcacg cctttttgga ttaccctcgg gacctatgac accgcaagta
      601 gttacattgt ggtatcgatc gcctgagtta ctgctgggat cacccactca aacaactgct
      661 gtcgatatgt gggccgtcgg ttgcatttta ggtgaacttc tatcacacaa accattgtta
      721 ccaggaaata ccgaaattgc tcaattggaa cttataattg acttattggg tactccatct
      781 gaagctatat ggccagatta tcccaaaatg ccggctatcc aaaattttac gcttaagaaa
      841 cagccgtaca acaacttaaa acctaaattt cagtatttat cggctgctgg attaaggcta
      901 ttaaatttcc tatttatgta tgaccctaag aagagagcga cgcctgagga gtgtcttcac
      961 agcacatatt tcaaagaacc accattacct tgtgacccca aattaatgcc tacattccct
     1021 caacatcgaa atatgcaaca caattctacg aaatctgcac caagtggagc ccatcacagt
     1081 ggacctgtac cggaattgcc tgctatttct gacttattgg gaagcctact taaaaaaaga
     1141 agagtagact aacagaattt ttctcacgaa tttttgtatc aaaaatgtat tgcatgaaaa
     1201 aattaacata ataaaatgca tttataaaac tagaaa