Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368105 912 bp mRNA linear INV 02-SEP-2023 protein 10-like (LOC131997317), transcript variant X3, mRNA. ACCESSION XM_059368105 VERSION XM_059368105.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..912 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..912 /gene="LOC131997317" /note="GATA zinc finger domain-containing protein 10-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997317" CDS 38..853 /gene="LOC131997317" /codon_start=1 /product="uncharacterized protein LOC131997317 isoform X3" /protein_id="XP_059224088.1" /db_xref="GeneID:131997317" /translation="MYKQEPFSRRGSLRSLRSAPLLSTVLESTLSLTRIHPIASLELP GLDYAIQSQSAIIHERRELGTSLRGIATITAGSTVPPPQTRLGPQASVRETKRSKQPQ RALSRKLKPHLVADTVKQYISRAQRPAKGSQEQQPNMEFLRGVYAFMQVSRSSVSHVK IDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNTYCWIHSTYT VVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQTKQLLVYK" ORIGIN 1 cctttgactc taatcctgtt ttcagtgagg atttcaaatg tataaacagg aaccgtttag 61 tcgccgcggt agtttgagat ccttacgcag tgctccttta cttagtaccg tcttagagag 121 caccctatcc ttgacgcgca tacacccaat tgcctcattg gaattgcccg gacttgatta 181 tgccatacaa tcgcaatcgg ccataataca tgagcgtcgt gaattgggca catccttgcg 241 tggcatagct accataaccg caggttcaac tgttccacca ccacagacac gcttgggacc 301 ccaggcttca gtgagggaaa ctaagcgtag caaacaaccg caacgagcat tatcacgtaa 361 actaaaacct catttagttg ccgacaccgt caaacagtat atcagtcgag cgcagcggcc 421 agccaaagga tctcaagagc agcagcctaa catggagttt ttacgtggtg tttatgcgtt 481 tatgcaagtg agtagatcat cggtgtctca tgtcaaaatc gattcacctg tatttcgcct 541 acacacaaat gcaaccgtta tattattaat aacattttca attgctgtta caacgcgtca 601 atacgtagga aatccaatag actgtgtaca tacgagagac attccggaag atgtacttaa 661 tacatattgt tggatacatt caacatatac agtggtggat gctttcatga aaaagcaagg 721 ttccgaggtg ccttttcctg gggttcataa ttcacaggga cgtggacctc taacaataaa 781 acatacaaaa tattatcaat gggtggcgtt tacgctattt tttcagacta aacagctttt 841 ggtttataaa taaccgaaat aaataattat taatttaatg ttatgtatgc ataaattaaa 901 taacttttat gt