Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans GATA zinc finger domain-containing


LOCUS       XM_059368105             912 bp    mRNA    linear   INV 02-SEP-2023
            protein 10-like (LOC131997317), transcript variant X3, mRNA.
ACCESSION   XM_059368105
VERSION     XM_059368105.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..912
                     /gene="LOC131997317"
                     /note="GATA zinc finger domain-containing protein 10-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon."
                     /db_xref="GeneID:131997317"
     CDS             38..853
                     /gene="LOC131997317"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997317 isoform X3"
                     /protein_id="XP_059224088.1"
                     /db_xref="GeneID:131997317"
                     /translation="MYKQEPFSRRGSLRSLRSAPLLSTVLESTLSLTRIHPIASLELP
                     GLDYAIQSQSAIIHERRELGTSLRGIATITAGSTVPPPQTRLGPQASVRETKRSKQPQ
                     RALSRKLKPHLVADTVKQYISRAQRPAKGSQEQQPNMEFLRGVYAFMQVSRSSVSHVK
                     IDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNTYCWIHSTYT
                     VVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQTKQLLVYK"
ORIGIN      
        1 cctttgactc taatcctgtt ttcagtgagg atttcaaatg tataaacagg aaccgtttag
       61 tcgccgcggt agtttgagat ccttacgcag tgctccttta cttagtaccg tcttagagag
      121 caccctatcc ttgacgcgca tacacccaat tgcctcattg gaattgcccg gacttgatta
      181 tgccatacaa tcgcaatcgg ccataataca tgagcgtcgt gaattgggca catccttgcg
      241 tggcatagct accataaccg caggttcaac tgttccacca ccacagacac gcttgggacc
      301 ccaggcttca gtgagggaaa ctaagcgtag caaacaaccg caacgagcat tatcacgtaa
      361 actaaaacct catttagttg ccgacaccgt caaacagtat atcagtcgag cgcagcggcc
      421 agccaaagga tctcaagagc agcagcctaa catggagttt ttacgtggtg tttatgcgtt
      481 tatgcaagtg agtagatcat cggtgtctca tgtcaaaatc gattcacctg tatttcgcct
      541 acacacaaat gcaaccgtta tattattaat aacattttca attgctgtta caacgcgtca
      601 atacgtagga aatccaatag actgtgtaca tacgagagac attccggaag atgtacttaa
      661 tacatattgt tggatacatt caacatatac agtggtggat gctttcatga aaaagcaagg
      721 ttccgaggtg ccttttcctg gggttcataa ttcacaggga cgtggacctc taacaataaa
      781 acatacaaaa tattatcaat gggtggcgtt tacgctattt tttcagacta aacagctttt
      841 ggtttataaa taaccgaaat aaataattat taatttaatg ttatgtatgc ataaattaaa
      901 taacttttat gt