Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368085 975 bp mRNA linear INV 02-SEP-2023 (LOC106080837), transcript variant X1, mRNA. ACCESSION XM_059368085 VERSION XM_059368085.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..975 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..975 /gene="LOC106080837" /note="glycine-rich selenoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106080837" CDS 120..431 /gene="LOC106080837" /codon_start=1 /product="glycine-rich selenoprotein" /protein_id="XP_059224068.1" /db_xref="GeneID:106080837" /translation="MVYIDRDGRVLEKRPWDMARIMGIFTGIWLVVVQFFQTLIAPFN QENRGGNRRSDGGGWGSGGGYGGGGGGGGSGGGGNGGLRPNRRIGRVTNSMDCNIPGG G" polyA_site 975 /gene="LOC106080837" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cacgtcattt ttaaaatcca caacgcaaaa tttagttata ttcttcgatt tttcaggaaa 61 taaacgcttg cagaagaaag ttctagtttt tgcataattt atgcggtcgc cattataaaa 121 tggtttacat agatcgcgat ggtcgagttt tggagaaacg accttgggac atggcccgca 181 taatgggcat tttcacaggg atatggcttg ttgttgtaca attcttccaa acactcattg 241 cgccatttaa ccaagagaac cgtggtggaa accgtcgcag tgatggtggt ggatggggat 301 ccggtggtgg ttatggcggc ggaggtggtg gtggtggtag tggcggtggg ggaaatggtg 361 gccttcgtcc caaccgtcgt attggccgtg taactaattc aatggattgt aatatacccg 421 gaggcggatg agcacggtaa agtgtccagg cattttgtac gagtaatgct gcttggtaac 481 atctcaagca tatttaatct cttttaaata caattgatgt gtttatttta gtattataca 541 gtgcaattca cgattaattg gctattttta tcggttatca catgatatcg atgaatctcc 601 agttcaactt ttcactggaa tgaactgcac tgaatagaac taaaataaaa catggcaaat 661 attactcgcc tggacacagc tgaccccgtt aaccaatccc taacagcatc aacatcatac 721 aaagtttttt tttttttttt taatatgctc acaaattcac ttttcggtac aaagttacct 781 ttatgacgac ccacttgtaa actcaaccca gagggaagtg agtctgatct ttaacaagag 841 tgatttttgt gcatataaac tttgtgggat tgaattttag taaaattttt ataaatattg 901 aaatacatat atttttgtgt attatactca tttatttttg atcaaaatac aacgcatctt 961 atacaaacaa actta