Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glycine-rich selenoprotein


LOCUS       XM_059368085             975 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080837), transcript variant X1, mRNA.
ACCESSION   XM_059368085
VERSION     XM_059368085.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..975
                     /gene="LOC106080837"
                     /note="glycine-rich selenoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106080837"
     CDS             120..431
                     /gene="LOC106080837"
                     /codon_start=1
                     /product="glycine-rich selenoprotein"
                     /protein_id="XP_059224068.1"
                     /db_xref="GeneID:106080837"
                     /translation="MVYIDRDGRVLEKRPWDMARIMGIFTGIWLVVVQFFQTLIAPFN
                     QENRGGNRRSDGGGWGSGGGYGGGGGGGGSGGGGNGGLRPNRRIGRVTNSMDCNIPGG
                     G"
     polyA_site      975
                     /gene="LOC106080837"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cacgtcattt ttaaaatcca caacgcaaaa tttagttata ttcttcgatt tttcaggaaa
       61 taaacgcttg cagaagaaag ttctagtttt tgcataattt atgcggtcgc cattataaaa
      121 tggtttacat agatcgcgat ggtcgagttt tggagaaacg accttgggac atggcccgca
      181 taatgggcat tttcacaggg atatggcttg ttgttgtaca attcttccaa acactcattg
      241 cgccatttaa ccaagagaac cgtggtggaa accgtcgcag tgatggtggt ggatggggat
      301 ccggtggtgg ttatggcggc ggaggtggtg gtggtggtag tggcggtggg ggaaatggtg
      361 gccttcgtcc caaccgtcgt attggccgtg taactaattc aatggattgt aatatacccg
      421 gaggcggatg agcacggtaa agtgtccagg cattttgtac gagtaatgct gcttggtaac
      481 atctcaagca tatttaatct cttttaaata caattgatgt gtttatttta gtattataca
      541 gtgcaattca cgattaattg gctattttta tcggttatca catgatatcg atgaatctcc
      601 agttcaactt ttcactggaa tgaactgcac tgaatagaac taaaataaaa catggcaaat
      661 attactcgcc tggacacagc tgaccccgtt aaccaatccc taacagcatc aacatcatac
      721 aaagtttttt tttttttttt taatatgctc acaaattcac ttttcggtac aaagttacct
      781 ttatgacgac ccacttgtaa actcaaccca gagggaagtg agtctgatct ttaacaagag
      841 tgatttttgt gcatataaac tttgtgggat tgaattttag taaaattttt ataaatattg
      901 aaatacatat atttttgtgt attatactca tttatttttg atcaaaatac aacgcatctt
      961 atacaaacaa actta