Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein 19a


LOCUS       XM_059368043             978 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091229), transcript variant X1, mRNA.
ACCESSION   XM_059368043
VERSION     XM_059368043.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..978
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..978
                     /gene="LOC106091229"
                     /note="general odorant-binding protein 19a; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:106091229"
     CDS             266..928
                     /gene="LOC106091229"
                     /codon_start=1
                     /product="large ribosomal subunit protein mL49 isoform X1"
                     /protein_id="XP_059224026.1"
                     /db_xref="GeneID:106091229"
                     /translation="MRIIQVFGPKPLMFHPFSFMVTLIIRRRCVILLPAIHSPIVLCL
                     LAVSAQIKIAYEHSIKKQLPVSARYSSYLSSDQVQSIDQYPEVEILKNPPEWKYVERL
                     LPKPVVPKVVHKAEYPSGWKPPAFTVADIDKLEYFVARSRNHMVPVYLETTFRGQRRV
                     TVVRHVQGNLWQLEKEIREIVEKARNGRKCATRVNEMSGQVRVHGDYVDIVREHLKAK
                     GY"
     polyA_site      978
                     /gene="LOC106091229"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaataagcaa tttaattttt ttttatgaaa tttgttagtc taatatgttg aaatgcttat
       61 atcgatggta catcgaaatc tttatttctc gcgctcatgt gtggtcactg cttggaattt
      121 ctgatacgtt tgagaaattg gtcaagttcc catatatcac caatgggtca agtttatatc
      181 cattggtcaa gatcctttat tttacccatt ggtcaacaaa aaagaaccca acgaaaaaag
      241 aaggacagcg gcaagatttg aacaaatgcg gattattcaa gtattcggtc cgaaacctct
      301 gatgttccat cccttttcat ttatggtcac attgattatc cgaaggcgat gcgtcatcct
      361 cttacctgca attcattctc ccatcgtctt atgtctatta gccgtgagtg ctcaaatcaa
      421 aattgcctac gaacattcca ttaagaaaca gttgccggta tcagcgcgct attccagcta
      481 tttgtcttcg gatcaggtgc aatcaattga ccaatatcct gaggttgaga ttcttaaaaa
      541 tcctccagaa tggaaatatg tggaacgatt gctgcccaaa ccagttgtcc ccaaggtagt
      601 gcataaggcc gagtatcctt ctggctggaa accaccagct ttcactgtag ccgatatcga
      661 caaactcgaa tactttgtgg cccgctcacg taatcatatg gttcccgttt atttggaaac
      721 aacatttcga ggacaacgcc gggtgaccgt agtaagacat gtgcaaggca atttatggca
      781 attggaaaaa gaaataaggg agatagtgga aaaggcacgc aatggcagaa aatgtgccac
      841 acgcgtcaac gaaatgagtg gtcaagtgcg agtacacggt gactatgtcg acattgtaag
      901 agaacattta aaagccaaag gctactaaaa aaataaaatt tattgccttt tgttaatttg
      961 ttaaaatttc cacactta