Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368043 978 bp mRNA linear INV 02-SEP-2023 (LOC106091229), transcript variant X1, mRNA. ACCESSION XM_059368043 VERSION XM_059368043.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..978 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..978 /gene="LOC106091229" /note="general odorant-binding protein 19a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106091229" CDS 266..928 /gene="LOC106091229" /codon_start=1 /product="large ribosomal subunit protein mL49 isoform X1" /protein_id="XP_059224026.1" /db_xref="GeneID:106091229" /translation="MRIIQVFGPKPLMFHPFSFMVTLIIRRRCVILLPAIHSPIVLCL LAVSAQIKIAYEHSIKKQLPVSARYSSYLSSDQVQSIDQYPEVEILKNPPEWKYVERL LPKPVVPKVVHKAEYPSGWKPPAFTVADIDKLEYFVARSRNHMVPVYLETTFRGQRRV TVVRHVQGNLWQLEKEIREIVEKARNGRKCATRVNEMSGQVRVHGDYVDIVREHLKAK GY" polyA_site 978 /gene="LOC106091229" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaataagcaa tttaattttt ttttatgaaa tttgttagtc taatatgttg aaatgcttat 61 atcgatggta catcgaaatc tttatttctc gcgctcatgt gtggtcactg cttggaattt 121 ctgatacgtt tgagaaattg gtcaagttcc catatatcac caatgggtca agtttatatc 181 cattggtcaa gatcctttat tttacccatt ggtcaacaaa aaagaaccca acgaaaaaag 241 aaggacagcg gcaagatttg aacaaatgcg gattattcaa gtattcggtc cgaaacctct 301 gatgttccat cccttttcat ttatggtcac attgattatc cgaaggcgat gcgtcatcct 361 cttacctgca attcattctc ccatcgtctt atgtctatta gccgtgagtg ctcaaatcaa 421 aattgcctac gaacattcca ttaagaaaca gttgccggta tcagcgcgct attccagcta 481 tttgtcttcg gatcaggtgc aatcaattga ccaatatcct gaggttgaga ttcttaaaaa 541 tcctccagaa tggaaatatg tggaacgatt gctgcccaaa ccagttgtcc ccaaggtagt 601 gcataaggcc gagtatcctt ctggctggaa accaccagct ttcactgtag ccgatatcga 661 caaactcgaa tactttgtgg cccgctcacg taatcatatg gttcccgttt atttggaaac 721 aacatttcga ggacaacgcc gggtgaccgt agtaagacat gtgcaaggca atttatggca 781 attggaaaaa gaaataaggg agatagtgga aaaggcacgc aatggcagaa aatgtgccac 841 acgcgtcaac gaaatgagtg gtcaagtgcg agtacacggt gactatgtcg acattgtaag 901 agaacattta aaagccaaag gctactaaaa aaataaaatt tattgccttt tgttaatttg 961 ttaaaatttc cacactta