Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997294


LOCUS       XM_059368009             724 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997294), transcript variant X2, mRNA.
ACCESSION   XM_059368009
VERSION     XM_059368009.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..724
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..724
                     /gene="LOC131997294"
                     /note="uncharacterized LOC131997294; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997294"
     CDS             51..680
                     /gene="LOC131997294"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997294"
                     /protein_id="XP_059223992.1"
                     /db_xref="GeneID:131997294"
                     /translation="MAPPTQRQKLRLKINKLKQQQMQAELQLHQYDRLQRQQREEWRW
                     RSGAYPDYEGGYISHYYRGHMSPPLRRPPPRSPPLRYEEYYERYNYESGRSYEPPSTR
                     QPALAPAYESGRGYEPPSTRQAAPATAYAGGRSYEPPSTRQPALAPAYESGRGYEPPS
                     TRQPAPAPAYESGRGYEQPSTRQPAPAPAYAGGRSYEPPSTRQPAPAPA"
ORIGIN      
        1 atgaaatttt ctcaaaaaaa gtataaaaat ttctcgaaag acaaaagttt atggcgcctc
       61 caactcaacg ccaaaaatta aggctaaaaa taaataaatt aaaacaacag caaatgcaag
      121 cggaattgca gttacaccaa tacgacaggc tacagcgaca gcagcgggag gaatggcggt
      181 ggcgaagtgg agcatacccc gattatgaag ggggatatat atcccactat tatagggggc
      241 acatgagccc cccactacgc agacccccac cacgcagccc cccattacgt tacgaagagt
      301 actatgaacg ttataattac gaaagtggcc gtagctacga gccaccatca acacgccaac
      361 cagctctagc tccagcgtac gaaagtggcc gtggctacga gccaccatca acacgccaag
      421 cagctccagc tacagcttac gcaggtggcc gtagctacga gccaccatca acacgccaac
      481 cagctctagc tccagcgtac gaaagtggcc gtggctacga gccaccatca acacgccaac
      541 cagctccagc tccagcttac gaaagtggcc gtggctatga gcaaccatca acacgccaac
      601 cagctccagc tccagcttac gcaggtggcc gtagctacga gccaccatca acacgccaac
      661 cagctccagc tccagcttag gcaggtggcc gtagctacga gccaccatca acacgccaac
      721 cagc