Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059368009 724 bp mRNA linear INV 02-SEP-2023 (LOC131997294), transcript variant X2, mRNA. ACCESSION XM_059368009 VERSION XM_059368009.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..724 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..724 /gene="LOC131997294" /note="uncharacterized LOC131997294; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997294" CDS 51..680 /gene="LOC131997294" /codon_start=1 /product="uncharacterized protein LOC131997294" /protein_id="XP_059223992.1" /db_xref="GeneID:131997294" /translation="MAPPTQRQKLRLKINKLKQQQMQAELQLHQYDRLQRQQREEWRW RSGAYPDYEGGYISHYYRGHMSPPLRRPPPRSPPLRYEEYYERYNYESGRSYEPPSTR QPALAPAYESGRGYEPPSTRQAAPATAYAGGRSYEPPSTRQPALAPAYESGRGYEPPS TRQPAPAPAYESGRGYEQPSTRQPAPAPAYAGGRSYEPPSTRQPAPAPA" ORIGIN 1 atgaaatttt ctcaaaaaaa gtataaaaat ttctcgaaag acaaaagttt atggcgcctc 61 caactcaacg ccaaaaatta aggctaaaaa taaataaatt aaaacaacag caaatgcaag 121 cggaattgca gttacaccaa tacgacaggc tacagcgaca gcagcgggag gaatggcggt 181 ggcgaagtgg agcatacccc gattatgaag ggggatatat atcccactat tatagggggc 241 acatgagccc cccactacgc agacccccac cacgcagccc cccattacgt tacgaagagt 301 actatgaacg ttataattac gaaagtggcc gtagctacga gccaccatca acacgccaac 361 cagctctagc tccagcgtac gaaagtggcc gtggctacga gccaccatca acacgccaag 421 cagctccagc tacagcttac gcaggtggcc gtagctacga gccaccatca acacgccaac 481 cagctctagc tccagcgtac gaaagtggcc gtggctacga gccaccatca acacgccaac 541 cagctccagc tccagcttac gaaagtggcc gtggctatga gcaaccatca acacgccaac 601 cagctccagc tccagcttac gcaggtggcc gtagctacga gccaccatca acacgccaac 661 cagctccagc tccagcttag gcaggtggcc gtagctacga gccaccatca acacgccaac 721 cagc