Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367967 658 bp mRNA linear INV 02-SEP-2023 (LOC131997283), mRNA. ACCESSION XM_059367967 VERSION XM_059367967.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..658 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..658 /gene="LOC131997283" /note="uncharacterized LOC131997283; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997283" CDS 28..588 /gene="LOC131997283" /codon_start=1 /product="uncharacterized protein LOC131997283" /protein_id="XP_059223950.1" /db_xref="GeneID:131997283" /translation="MNINNQQDVFSWSKLGDVLDDKLKDVAKKEDLTAIKYEVEELKQ ENCKLREDIKKLTNRLETLDRKSRTTNIVVSGLRSRTTFTAKKEFLDICNNKLNIVVN ISYARMLSSGKSFVFTLDTNSQVQNILNTKEKLHGQFIYIQKDYTAVEQSTRYNLRQV GKIVSQHKKDVKVRLGEFCLFLLNLV" ORIGIN 1 ccaaaaaagt attcaccata tcaaaaaatg aacataaata accaacaaga tgttttttcg 61 tggagtaagc tgggcgatgt gttggatgat aagttgaaag atgtggccaa aaaagaggac 121 cttactgcaa tcaaatatga agtggaagaa cttaaacagg aaaattgtaa attgagagaa 181 gatatcaaga aactaacaaa tcgcttagaa accttagaca gaaaatctcg tactacaaat 241 attgtggtga gtggacttag aagtagaact acatttacgg caaaaaaaga attcctcgac 301 atctgcaaca acaaattaaa catcgtagtt aacatatcgt acgctagaat gttatcttca 361 ggaaaatcgt tcgtatttac actggacacc aattcccaag tgcaaaatat tttaaatacg 421 aaagaaaaat tgcatggcca atttatatat atacaaaagg attatactgc tgtcgaacag 481 tctaccagat acaacctgcg tcaagttggc aaaatcgtat cccagcataa aaaagacgtt 541 aaagttaggt taggagagtt ctgtcttttc ctgttgaatc tggtgtgaaa cagggctgta 601 ttctcagtcc tgtactcttt tcgttatacg tgaatgacct tccctatata ttgcctgg