Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997283


LOCUS       XM_059367967             658 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997283), mRNA.
ACCESSION   XM_059367967
VERSION     XM_059367967.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..658
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..658
                     /gene="LOC131997283"
                     /note="uncharacterized LOC131997283; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997283"
     CDS             28..588
                     /gene="LOC131997283"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997283"
                     /protein_id="XP_059223950.1"
                     /db_xref="GeneID:131997283"
                     /translation="MNINNQQDVFSWSKLGDVLDDKLKDVAKKEDLTAIKYEVEELKQ
                     ENCKLREDIKKLTNRLETLDRKSRTTNIVVSGLRSRTTFTAKKEFLDICNNKLNIVVN
                     ISYARMLSSGKSFVFTLDTNSQVQNILNTKEKLHGQFIYIQKDYTAVEQSTRYNLRQV
                     GKIVSQHKKDVKVRLGEFCLFLLNLV"
ORIGIN      
        1 ccaaaaaagt attcaccata tcaaaaaatg aacataaata accaacaaga tgttttttcg
       61 tggagtaagc tgggcgatgt gttggatgat aagttgaaag atgtggccaa aaaagaggac
      121 cttactgcaa tcaaatatga agtggaagaa cttaaacagg aaaattgtaa attgagagaa
      181 gatatcaaga aactaacaaa tcgcttagaa accttagaca gaaaatctcg tactacaaat
      241 attgtggtga gtggacttag aagtagaact acatttacgg caaaaaaaga attcctcgac
      301 atctgcaaca acaaattaaa catcgtagtt aacatatcgt acgctagaat gttatcttca
      361 ggaaaatcgt tcgtatttac actggacacc aattcccaag tgcaaaatat tttaaatacg
      421 aaagaaaaat tgcatggcca atttatatat atacaaaagg attatactgc tgtcgaacag
      481 tctaccagat acaacctgcg tcaagttggc aaaatcgtat cccagcataa aaaagacgtt
      541 aaagttaggt taggagagtt ctgtcttttc ctgttgaatc tggtgtgaaa cagggctgta
      601 ttctcagtcc tgtactcttt tcgttatacg tgaatgacct tccctatata ttgcctgg