Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094055


LOCUS       XM_059367954             303 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094055), transcript variant X1, mRNA.
ACCESSION   XM_059367954
VERSION     XM_059367954.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..303
                     /gene="LOC106094055"
                     /note="uncharacterized LOC106094055; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106094055"
     CDS             1..303
                     /gene="LOC106094055"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094055"
                     /protein_id="XP_059223937.1"
                     /db_xref="GeneID:106094055"
                     /translation="MRVYVYNLMLMSISVKYFYKMVNERSGTIEQLRQWNSFNPCGLQ
                     VLFSGRIVAADIGLDRCQYYHLEFLQERECARKVYPRLTVKKLDENLLQFRCLVSS"
ORIGIN      
        1 atgcgtgtat atgtatataa tttaatgctt atgtctatat cagttaaata tttttataaa
       61 atggtaaacg aacgttcagg tacaatagaa caattgcgac aatggaattc atttaacccc
      121 tgtgggctcc aggtactgtt ttctggaaga atagtggcag cagacattgg gctggatcgt
      181 tgtcaatatt atcatttaga attcctacag gagagagaat gcgctcgaaa agtttaccca
      241 cgtttgacag taaagaaatt ggacgaaaat ctgctgcagt ttcgctgttt ggtttcttct
      301 tga