Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367954 303 bp mRNA linear INV 02-SEP-2023 (LOC106094055), transcript variant X1, mRNA. ACCESSION XM_059367954 VERSION XM_059367954.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..303 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..303 /gene="LOC106094055" /note="uncharacterized LOC106094055; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094055" CDS 1..303 /gene="LOC106094055" /codon_start=1 /product="uncharacterized protein LOC106094055" /protein_id="XP_059223937.1" /db_xref="GeneID:106094055" /translation="MRVYVYNLMLMSISVKYFYKMVNERSGTIEQLRQWNSFNPCGLQ VLFSGRIVAADIGLDRCQYYHLEFLQERECARKVYPRLTVKKLDENLLQFRCLVSS" ORIGIN 1 atgcgtgtat atgtatataa tttaatgctt atgtctatat cagttaaata tttttataaa 61 atggtaaacg aacgttcagg tacaatagaa caattgcgac aatggaattc atttaacccc 121 tgtgggctcc aggtactgtt ttctggaaga atagtggcag cagacattgg gctggatcgt 181 tgtcaatatt atcatttaga attcctacag gagagagaat gcgctcgaaa agtttaccca 241 cgtttgacag taaagaaatt ggacgaaaat ctgctgcagt ttcgctgttt ggtttcttct 301 tga