Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367949 932 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059367949 VERSION XM_059367949.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..932 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..932 /gene="LOC106094050" /note="protein YIPF5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106094050" CDS 90..872 /gene="LOC106094050" /codon_start=1 /product="protein YIPF5" /protein_id="XP_059223932.1" /db_xref="GeneID:106094050" /translation="MANFGGQNEFYSSGDNSYNFDMPEFDQELDFQNFENTQTSVPPN YDLNYANTNSSGMSSFYDPSAYSQNAYDQSDKRFKAGGSVGNDFEDEPPLLEELGINP NHIFQKTLAVLNPMRGADQQILQDTDMAGPLVFCLALGGFLLLSGKVTFSYIYGIGVM GSIAFYCLLSLMASQANVTFGAVVSVLGYCLLPMVVLSGVNVLITIQGTVGLIVAAVC IFWCSLSASKLFVTAYSMDHQQVLIAYPCALLYGVFALITIF" polyA_site 932 /gene="LOC106094050" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agccgccttc gttcactgtc cctagggtga cgtggtattg tattgttttt tgatttgtaa 61 gattaaaata taaaaaaagt aaatcaaata tggccaactt tggtggacaa aatgaatttt 121 actcgtctgg cgataattcg tataactttg atatgccgga atttgatcag gagttagact 181 ttcagaattt tgaaaatacg caaacatcgg ttccgccaaa ttatgactta aattacgcga 241 acaccaatag cagtggaatg agctcttttt atgacccaag cgcatattcg caaaatgctt 301 atgaccaaag tgacaaacgt ttcaaagctg gtggcagtgt aggtaatgac ttcgaagatg 361 aaccgccctt attggaagag ttgggtatta accctaatca catatttcaa aagactttgg 421 ctgtattaaa tccaatgcgt ggagcggacc aacaaatact tcaagacaca gatatggcgg 481 gtccattggt attctgtttg gcgttgggtg gatttttatt attgagtgga aaagtcacat 541 tttcttacat atacggcatt ggtgttatgg gaagcattgc attttattgt ttacttagtc 601 taatggcatc acaagctaat gttactttcg gtgctgttgt atctgtttta ggatattgtt 661 tactaccgat ggtcgttcta tcaggcgtaa acgtcttgat tactatacag ggaactgttg 721 gtttaattgt tgctgcagtt tgtatatttt ggtgttcatt gtcagcctcc aaactttttg 781 tgacagcata ctcaatggat caccaacaag ttttgattgc atacccttgt gctttactat 841 atggagtatt cgcattaata acaatatttt agaaatatca tattgtagat tacagcaaaa 901 ataaaatata tctattactg cagcaaacag aa