Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367936 460 bp mRNA linear INV 02-SEP-2023 (LOC131997264), mRNA. ACCESSION XM_059367936 VERSION XM_059367936.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..460 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..460 /gene="LOC131997264" /note="uncharacterized LOC131997264; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997264" CDS 45..347 /gene="LOC131997264" /codon_start=1 /product="uncharacterized protein LOC131997264" /protein_id="XP_059223919.1" /db_xref="GeneID:131997264" /translation="MLSKLSLLFFCGITLSLICMGSAQGQGEWGGARDSQSDHQGHPG QWDNYGNPPWNNNQNSHSMDHSYHSHAAATASTWSLNNFVVMAAMLLLCIFQNTNV" polyA_site 460 /gene="LOC131997264" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cttaataaac ctttcagtag ataagcaaac gtttacaagc caacatgtta tctaaactgt 61 cgttactatt cttttgtgga atcacactga gtttgatttg catgggttca gcccaaggcc 121 aaggcgaatg gggtggtgct cgtgacagcc aatcggatca tcagggtcat cctggacaat 181 gggataatta tggcaatcct ccatggaata acaatcaaaa tagtcattcg atggatcata 241 gctatcacag tcacgcggca gcaactgcat cgacttggtc attaaacaat tttgtagtaa 301 tggctgccat gttgttgtta tgcatttttc aaaatactaa tgtttgattt ttaaaccatc 361 aacaattata tttgaaagga gtaaacaaat tgtttgtaaa tatttgaaat aaaaaatgtt 421 tgtaaaagta aaaggacttg taagtcctga aatttgaaaa