Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997264


LOCUS       XM_059367936             460 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997264), mRNA.
ACCESSION   XM_059367936
VERSION     XM_059367936.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..460
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..460
                     /gene="LOC131997264"
                     /note="uncharacterized LOC131997264; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997264"
     CDS             45..347
                     /gene="LOC131997264"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997264"
                     /protein_id="XP_059223919.1"
                     /db_xref="GeneID:131997264"
                     /translation="MLSKLSLLFFCGITLSLICMGSAQGQGEWGGARDSQSDHQGHPG
                     QWDNYGNPPWNNNQNSHSMDHSYHSHAAATASTWSLNNFVVMAAMLLLCIFQNTNV"
     polyA_site      460
                     /gene="LOC131997264"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cttaataaac ctttcagtag ataagcaaac gtttacaagc caacatgtta tctaaactgt
       61 cgttactatt cttttgtgga atcacactga gtttgatttg catgggttca gcccaaggcc
      121 aaggcgaatg gggtggtgct cgtgacagcc aatcggatca tcagggtcat cctggacaat
      181 gggataatta tggcaatcct ccatggaata acaatcaaaa tagtcattcg atggatcata
      241 gctatcacag tcacgcggca gcaactgcat cgacttggtc attaaacaat tttgtagtaa
      301 tggctgccat gttgttgtta tgcatttttc aaaatactaa tgtttgattt ttaaaccatc
      361 aacaattata tttgaaagga gtaaacaaat tgtttgtaaa tatttgaaat aaaaaatgtt
      421 tgtaaaagta aaaggacttg taagtcctga aatttgaaaa