Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367917 1124 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059367917 VERSION XM_059367917.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1124 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1124 /gene="LOC106086023" /note="ficolin-2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106086023" CDS 31..1053 /gene="LOC106086023" /codon_start=1 /product="ficolin-2" /protein_id="XP_059223900.1" /db_xref="GeneID:106086023" /translation="MKILTCLLILYAAGRSTSMAFDNSNINDPEAEDNSEVLWKVLYT KLNVIMHATGKLGQSISDLQKRQQDQEQRTKDFLESMNADVKKYMDDNFAELQKTQVE QESKLLDIAQKLDDYHMESNQRFDDLTYRQNNQEDLILAINNQTQSQSWTTILQRLDG SVDFYRDWDQYKVGFGNPPNGEFFIGLDKLHELTSESPQELMVVMREWSGEMVHAHYD LFKIAGEKEKYAITSLGNYNGDAEDALDYHLGMAFSTYDQDNDLSTRNCAEYFKGAWW FRSCYASHLNGPYRLEAAAQQAGVSWDKWKKDYSFQYAVMQIRPKTFWKPIQVTEDDD NNTNNN" ORIGIN 1 tgtgtgcggt gaaacattca atgaaacaaa atgaaaattt taacttgtct acttattttg 61 tatgcagcag gacgctcaac atcaatggcg ttcgataact caaatataaa tgatcccgaa 121 gccgaggaca acagtgaagt tttgtggaaa gtgttataca ccaaactgaa tgttatcatg 181 catgcaacgg gcaagttagg tcaaagcatt tcggatttgc aaaaaaggca gcaagatcaa 241 gagcaacgta ctaaggactt tttggaaagt atgaatgcgg atgtcaaaaa gtatatggat 301 gataattttg cggaattaca aaaaacgcaa gttgagcagg aaagcaaact tttggacatt 361 gcccaaaaac tggatgatta tcatatggaa tccaatcaaa gattcgatga tctcacctat 421 agacaaaata accaagaaga tttaatattg gccatcaaca atcaaactca aagtcaatcc 481 tggaccacca ttttacaacg tttggatggt tcggttgatt tctatcgcga ttgggatcaa 541 tacaaagtgg gctttggcaa tccaccaaat ggtgaattct ttattggcct tgacaagctg 601 catgaattga cctctgaaag tccccaggag ttaatggtgg tgatgcgtga atggagcggt 661 gaaatggtac atgctcacta tgatctcttc aaaattgccg gagagaaaga gaaatatgcc 721 attacctctc ttggcaatta taatggtgat gctgaagatg ccctggacta tcatttgggt 781 atggctttct caacctatga tcaggacaac gatttatcta cgcgtaattg tgccgagtac 841 tttaagggtg cctggtggtt tagatcatgt tatgccagcc atctgaatgg tccctatcgc 901 ttggaagctg ctgcccagca ggctggtgtt agctgggata aatggaagaa agactattcg 961 tttcaatatg cggtaatgca aataaggccc aagaccttct ggaaaccaat tcaagtaact 1021 gaagatgatg ataataacac caacaacaat taatttttga ataaaaaaac taaaaaaaaa 1081 aattaataaa aatcacagct tgtaaaattg aaaatttgca tcgg