Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ficolin-2 (LOC106086023), mRNA.


LOCUS       XM_059367917            1124 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059367917
VERSION     XM_059367917.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1124
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1124
                     /gene="LOC106086023"
                     /note="ficolin-2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106086023"
     CDS             31..1053
                     /gene="LOC106086023"
                     /codon_start=1
                     /product="ficolin-2"
                     /protein_id="XP_059223900.1"
                     /db_xref="GeneID:106086023"
                     /translation="MKILTCLLILYAAGRSTSMAFDNSNINDPEAEDNSEVLWKVLYT
                     KLNVIMHATGKLGQSISDLQKRQQDQEQRTKDFLESMNADVKKYMDDNFAELQKTQVE
                     QESKLLDIAQKLDDYHMESNQRFDDLTYRQNNQEDLILAINNQTQSQSWTTILQRLDG
                     SVDFYRDWDQYKVGFGNPPNGEFFIGLDKLHELTSESPQELMVVMREWSGEMVHAHYD
                     LFKIAGEKEKYAITSLGNYNGDAEDALDYHLGMAFSTYDQDNDLSTRNCAEYFKGAWW
                     FRSCYASHLNGPYRLEAAAQQAGVSWDKWKKDYSFQYAVMQIRPKTFWKPIQVTEDDD
                     NNTNNN"
ORIGIN      
        1 tgtgtgcggt gaaacattca atgaaacaaa atgaaaattt taacttgtct acttattttg
       61 tatgcagcag gacgctcaac atcaatggcg ttcgataact caaatataaa tgatcccgaa
      121 gccgaggaca acagtgaagt tttgtggaaa gtgttataca ccaaactgaa tgttatcatg
      181 catgcaacgg gcaagttagg tcaaagcatt tcggatttgc aaaaaaggca gcaagatcaa
      241 gagcaacgta ctaaggactt tttggaaagt atgaatgcgg atgtcaaaaa gtatatggat
      301 gataattttg cggaattaca aaaaacgcaa gttgagcagg aaagcaaact tttggacatt
      361 gcccaaaaac tggatgatta tcatatggaa tccaatcaaa gattcgatga tctcacctat
      421 agacaaaata accaagaaga tttaatattg gccatcaaca atcaaactca aagtcaatcc
      481 tggaccacca ttttacaacg tttggatggt tcggttgatt tctatcgcga ttgggatcaa
      541 tacaaagtgg gctttggcaa tccaccaaat ggtgaattct ttattggcct tgacaagctg
      601 catgaattga cctctgaaag tccccaggag ttaatggtgg tgatgcgtga atggagcggt
      661 gaaatggtac atgctcacta tgatctcttc aaaattgccg gagagaaaga gaaatatgcc
      721 attacctctc ttggcaatta taatggtgat gctgaagatg ccctggacta tcatttgggt
      781 atggctttct caacctatga tcaggacaac gatttatcta cgcgtaattg tgccgagtac
      841 tttaagggtg cctggtggtt tagatcatgt tatgccagcc atctgaatgg tccctatcgc
      901 ttggaagctg ctgcccagca ggctggtgtt agctgggata aatggaagaa agactattcg
      961 tttcaatatg cggtaatgca aataaggccc aagaccttct ggaaaccaat tcaagtaact
     1021 gaagatgatg ataataacac caacaacaat taatttttga ataaaaaaac taaaaaaaaa
     1081 aattaataaa aatcacagct tgtaaaattg aaaatttgca tcgg