Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997260


LOCUS       XM_059367913             826 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997260), mRNA.
ACCESSION   XM_059367913
VERSION     XM_059367913.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..826
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..826
                     /gene="LOC131997260"
                     /note="uncharacterized LOC131997260; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997260"
     CDS             19..642
                     /gene="LOC131997260"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997260"
                     /protein_id="XP_059223896.1"
                     /db_xref="GeneID:131997260"
                     /translation="MNAQDLYKCMLCKKRHALRFCPQFILMTVEDRRAAVRQHRYCRN
                     CLAKSHSVVECQSTDRCRKCGFQHHTMLHPRKLVLKSKSSNAASKSHSSNQPTSSRPQ
                     RNPAAQSNATAKSRLGQRQHSASAGQQQQQQRRAKRHNKPKGQRSHQQQPPKHQRKLK
                     TQKSNKERPLTPQPNYLILSEAIKSLATVLCASPNLAQAQGRRHGQI"
ORIGIN      
        1 accgcagcaa ggtcaaatat gaatgcccaa gatttataca agtgcatgct ttgcaaaaaa
       61 cgtcatgccc tcaggttctg cccacaattt atactgatga ctgtagaaga caggagagcc
      121 gccgttcgac aacaccgtta ctgtcgaaat tgtctggcaa aaagccattc tgtagtagag
      181 tgtcagtcga cggataggtg ccgaaaatgt gggtttcagc atcatacaat gctgcaccca
      241 cgaaaacttg tactgaagtc aaaaagctcc aacgccgcct ccaagtcgca ctcatctaac
      301 caaccaactt catctcggcc ccaaagaaat ccagcagcac agtccaatgc cacagccaaa
      361 tcacgccttg gccaacgtca gcactcagct tcggctggcc aacaacaaca acaacaaagg
      421 cgagccaaaa ggcacaataa accaaagggt caaagaagcc accaacaaca accacccaag
      481 caccaacgaa aattgaagac ccaaaagtcc aacaaagagc gcccactaac tccacaaccc
      541 aactacttaa ttttatctga agccatcaag tcgttggcaa cagtgttatg cgcttcacca
      601 aatcttgcgc aagcgcaagg ccggcgccat ggacaaattt gaatttgtcc ctttaattta
      661 agtacaatct atcgtagaat aagtcgaagt atatgaagtc aaattgtgaa ttgtaaatga
      721 atttgtagca cgtaagaaaa tatctattag cactaagtgt atatattgtg aatttctaat
      781 cttaagccat ttttagtact taagctcatc tgcaattctt ttacta