Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367913 826 bp mRNA linear INV 02-SEP-2023 (LOC131997260), mRNA. ACCESSION XM_059367913 VERSION XM_059367913.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..826 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..826 /gene="LOC131997260" /note="uncharacterized LOC131997260; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997260" CDS 19..642 /gene="LOC131997260" /codon_start=1 /product="uncharacterized protein LOC131997260" /protein_id="XP_059223896.1" /db_xref="GeneID:131997260" /translation="MNAQDLYKCMLCKKRHALRFCPQFILMTVEDRRAAVRQHRYCRN CLAKSHSVVECQSTDRCRKCGFQHHTMLHPRKLVLKSKSSNAASKSHSSNQPTSSRPQ RNPAAQSNATAKSRLGQRQHSASAGQQQQQQRRAKRHNKPKGQRSHQQQPPKHQRKLK TQKSNKERPLTPQPNYLILSEAIKSLATVLCASPNLAQAQGRRHGQI" ORIGIN 1 accgcagcaa ggtcaaatat gaatgcccaa gatttataca agtgcatgct ttgcaaaaaa 61 cgtcatgccc tcaggttctg cccacaattt atactgatga ctgtagaaga caggagagcc 121 gccgttcgac aacaccgtta ctgtcgaaat tgtctggcaa aaagccattc tgtagtagag 181 tgtcagtcga cggataggtg ccgaaaatgt gggtttcagc atcatacaat gctgcaccca 241 cgaaaacttg tactgaagtc aaaaagctcc aacgccgcct ccaagtcgca ctcatctaac 301 caaccaactt catctcggcc ccaaagaaat ccagcagcac agtccaatgc cacagccaaa 361 tcacgccttg gccaacgtca gcactcagct tcggctggcc aacaacaaca acaacaaagg 421 cgagccaaaa ggcacaataa accaaagggt caaagaagcc accaacaaca accacccaag 481 caccaacgaa aattgaagac ccaaaagtcc aacaaagagc gcccactaac tccacaaccc 541 aactacttaa ttttatctga agccatcaag tcgttggcaa cagtgttatg cgcttcacca 601 aatcttgcgc aagcgcaagg ccggcgccat ggacaaattt gaatttgtcc ctttaattta 661 agtacaatct atcgtagaat aagtcgaagt atatgaagtc aaattgtgaa ttgtaaatga 721 atttgtagca cgtaagaaaa tatctattag cactaagtgt atatattgtg aatttctaat 781 cttaagccat ttttagtact taagctcatc tgcaattctt ttacta