Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase-like


LOCUS       XM_059367909             850 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089540), mRNA.
ACCESSION   XM_059367909
VERSION     XM_059367909.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..850
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..850
                     /gene="LOC106089540"
                     /note="farnesol dehydrogenase-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106089540"
     CDS             6..758
                     /gene="LOC106089540"
                     /codon_start=1
                     /product="farnesol dehydrogenase-like"
                     /protein_id="XP_059223892.1"
                     /db_xref="GeneID:106089540"
                     /translation="MERWQNKVAVITGASSGIGAAIAKEFVMAGLKVVGLARRTHLIE
                     EMKNSLPLDKRSQLIAIYCDLSKPESIDKAFDAIISQCGGIDVLVNNAICFKVSLAVN
                     MPCNDLQELVQTNFMAIVHCTQKAFKSMKERNFNGHVIMINSIGGYAVLDRALFQMPC
                     SNIYSPCKFALRALTELYRQEFHGLGTKIKISSISPGCVNTESLNEDYRQALEHCMLQ
                     PHDVSKAVLFMLSTPPHLQIHDMIIKPLGEKV"
ORIGIN      
        1 ttaacatgga acgttggcaa aataaagtgg ctgtcattac tggcgctagt tctggcatag
       61 gggcagctat agccaaggaa tttgttatgg ccggtttaaa agtggttggg ctagctcgac
      121 gcacacactt gattgaggaa atgaaaaata gtcttccctt ggataaacgt tcccagctaa
      181 tcgccatcta ttgtgatctt tccaaaccag agtctataga taaagcattc gatgcgatca
      241 tttcacaatg tggtggcatt gatgttttgg ttaataatgc catttgcttt aaggttagtc
      301 tagcggtcaa catgccctgt aatgatctac aagagttggt gcaaaccaat tttatggcta
      361 tcgtccattg tacacaaaaa gccttcaaat cgatgaagga gcgcaatttc aatgggcatg
      421 ttataatgat aaacagcata ggcggttatg cagttttaga cagagcactt tttcaaatgc
      481 cttgctccaa tatctactcg ccttgtaagt tcgctttgag agctttaaca gaactgtaca
      541 ggcaggaatt ccatggcttg ggtacaaaaa tcaaaatctc gagcataagc cctggatgtg
      601 taaataccga atccttgaat gaggattatc gtcaggcctt ggaacactgt atgctacaac
      661 cccatgatgt gtcgaaagcc gttttgttta tgctctccac acctccacat cttcaaatac
      721 atgacatgat tataaagcca cttggggaga aagtttaaga agtgcatcgt gtactgacta
      781 tgtccttatt actgtaagaa aaaatcacaa ataaacaagt taaccagtta ggattggcaa
      841 aagtcgggcg