Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367902 714 bp mRNA linear INV 02-SEP-2023 (LOC106090721), mRNA. ACCESSION XM_059367902 VERSION XM_059367902.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..714 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..714 /gene="LOC106090721" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106090721" CDS 29..631 /gene="LOC106090721" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_059223885.1" /db_xref="GeneID:106090721" /translation="MLAKGFVLFVALFQLASAAYWYTAGDGNHYLIEGATNYNWLQAF DQCARQGLQLAVVDNASKNSALTALLRLVFGSSPDLWIGHHDEFNTKVDKNRLWFSPF SGLPISFSNWASIQPDNNNQNEHCVQISRVMNYQWNDAFCEHKFGFICEHSPRSQISV ARESTQENVNEFIEYAGSEVDKGQDPPKVLTEILKIPPMN" ORIGIN 1 attttcaatt tatcaaagct agtatctcat gttggcgaaa ggttttgttt tattcgtggc 61 actgttccaa ttggcttcgg cagcctattg gtatacggct ggcgatggga atcattattt 121 aatcgaagga gccacaaatt acaattggct gcaggccttt gatcaatgcg cccgccaggg 181 tttgcaactt gcagtcgttg ataatgcatc aaaaaattcg gctttgactg cacttttgcg 241 tttggtattt ggtagttcac ctgatttatg gatcggccat catgatgaat tcaatacaaa 301 ggttgacaaa aatcgcttat ggttctcccc ctttagtggt ctaccgattt cctttagtaa 361 ctgggcctct attcagcccg ataacaacaa tcaaaacgaa cactgtgtgc aaatatctcg 421 cgttatgaac taccaatgga atgatgcatt ttgtgaacat aagtttggct tcatttgtga 481 acattctcct cgttcccaga tttctgtagc tcgtgaaagt actcaagaaa atgtcaatga 541 attcattgag tacgccggca gtgaggtaga taaggggcaa gatcctccaa aagtattaac 601 ggaaatttta aaaatccccc ctatgaatta atcagtaaac aaatgcataa gaaaatgtgt 661 cctcaaaaca gaagttgcaa taaagtgcaa ctttctattc ccatcaccat acag