Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_059367902             714 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090721), mRNA.
ACCESSION   XM_059367902
VERSION     XM_059367902.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..714
                     /gene="LOC106090721"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106090721"
     CDS             29..631
                     /gene="LOC106090721"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_059223885.1"
                     /db_xref="GeneID:106090721"
                     /translation="MLAKGFVLFVALFQLASAAYWYTAGDGNHYLIEGATNYNWLQAF
                     DQCARQGLQLAVVDNASKNSALTALLRLVFGSSPDLWIGHHDEFNTKVDKNRLWFSPF
                     SGLPISFSNWASIQPDNNNQNEHCVQISRVMNYQWNDAFCEHKFGFICEHSPRSQISV
                     ARESTQENVNEFIEYAGSEVDKGQDPPKVLTEILKIPPMN"
ORIGIN      
        1 attttcaatt tatcaaagct agtatctcat gttggcgaaa ggttttgttt tattcgtggc
       61 actgttccaa ttggcttcgg cagcctattg gtatacggct ggcgatggga atcattattt
      121 aatcgaagga gccacaaatt acaattggct gcaggccttt gatcaatgcg cccgccaggg
      181 tttgcaactt gcagtcgttg ataatgcatc aaaaaattcg gctttgactg cacttttgcg
      241 tttggtattt ggtagttcac ctgatttatg gatcggccat catgatgaat tcaatacaaa
      301 ggttgacaaa aatcgcttat ggttctcccc ctttagtggt ctaccgattt cctttagtaa
      361 ctgggcctct attcagcccg ataacaacaa tcaaaacgaa cactgtgtgc aaatatctcg
      421 cgttatgaac taccaatgga atgatgcatt ttgtgaacat aagtttggct tcatttgtga
      481 acattctcct cgttcccaga tttctgtagc tcgtgaaagt actcaagaaa atgtcaatga
      541 attcattgag tacgccggca gtgaggtaga taaggggcaa gatcctccaa aagtattaac
      601 ggaaatttta aaaatccccc ctatgaatta atcagtaaac aaatgcataa gaaaatgtgt
      661 cctcaaaaca gaagttgcaa taaagtgcaa ctttctattc ccatcaccat acag