Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997248


LOCUS       XM_059367901             537 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997248), mRNA.
ACCESSION   XM_059367901
VERSION     XM_059367901.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..537
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..537
                     /gene="LOC131997248"
                     /note="uncharacterized LOC131997248; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997248"
     CDS             30..533
                     /gene="LOC131997248"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997248"
                     /protein_id="XP_059223884.1"
                     /db_xref="GeneID:131997248"
                     /translation="MGTTNDGNTARRFFENPAKTADVIGIKEELIHRFKIILAAINCN
                     AAVDTRKFHIYCMDTAKLFVDLYGWYYMPVTVHKILVHGSKIIAEAILPIGMLSEEAQ
                     EARNKDYRAYRLHHSRRIGRVATNEDVMHNLLLSSDPFINRFRSKLQIKKLEYDNDVK
                     KLLKDYA"
     polyA_site      537
                     /gene="LOC131997248"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcataaatgt ggacgcggtg aagcaaggta tgggcacaac aaacgatggc aatacggcaa
       61 gaaggttttt cgaaaatcca gccaaaactg cagacgtaat tggaataaaa gaagagttaa
      121 tacatagatt taaaattatt ttggccgcaa taaattgtaa tgcagcagtc gacactagaa
      181 aatttcatat atattgcatg gatactgcca agttgtttgt tgatctctat ggctggtact
      241 acatgcctgt aactgtgcat aagattctgg tgcatggtag caaaattata gcagaagcta
      301 ttctgccaat aggtatgctg tccgaagaag ctcaggaagc gaggaataaa gattatagag
      361 cctatagatt acatcattcg cgaagaattg gacgtgtagc cactaatgaa gatgtaatgc
      421 ataacctttt attgtcttca gacccattta taaatagatt tcgctcaaag ctgcaaatca
      481 aaaaattgga gtacgataat gatgttaaaa aattattaaa agactatgct taattta