Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367901 537 bp mRNA linear INV 02-SEP-2023 (LOC131997248), mRNA. ACCESSION XM_059367901 VERSION XM_059367901.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..537 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..537 /gene="LOC131997248" /note="uncharacterized LOC131997248; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997248" CDS 30..533 /gene="LOC131997248" /codon_start=1 /product="uncharacterized protein LOC131997248" /protein_id="XP_059223884.1" /db_xref="GeneID:131997248" /translation="MGTTNDGNTARRFFENPAKTADVIGIKEELIHRFKIILAAINCN AAVDTRKFHIYCMDTAKLFVDLYGWYYMPVTVHKILVHGSKIIAEAILPIGMLSEEAQ EARNKDYRAYRLHHSRRIGRVATNEDVMHNLLLSSDPFINRFRSKLQIKKLEYDNDVK KLLKDYA" polyA_site 537 /gene="LOC131997248" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcataaatgt ggacgcggtg aagcaaggta tgggcacaac aaacgatggc aatacggcaa 61 gaaggttttt cgaaaatcca gccaaaactg cagacgtaat tggaataaaa gaagagttaa 121 tacatagatt taaaattatt ttggccgcaa taaattgtaa tgcagcagtc gacactagaa 181 aatttcatat atattgcatg gatactgcca agttgtttgt tgatctctat ggctggtact 241 acatgcctgt aactgtgcat aagattctgg tgcatggtag caaaattata gcagaagcta 301 ttctgccaat aggtatgctg tccgaagaag ctcaggaagc gaggaataaa gattatagag 361 cctatagatt acatcattcg cgaagaattg gacgtgtagc cactaatgaa gatgtaatgc 421 ataacctttt attgtcttca gacccattta taaatagatt tcgctcaaag ctgcaaatca 481 aaaaattgga gtacgataat gatgttaaaa aattattaaa agactatgct taattta