Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997240


LOCUS       XM_059367878             562 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997240), mRNA.
ACCESSION   XM_059367878
VERSION     XM_059367878.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..562
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..562
                     /gene="LOC131997240"
                     /note="uncharacterized LOC131997240; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997240"
     CDS             2..562
                     /gene="LOC131997240"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997240"
                     /protein_id="XP_059223861.1"
                     /db_xref="GeneID:131997240"
                     /translation="MLQNGLFFLIIWYCLNTTETAANWNFILSFPQLICKPIIPQVIK
                     RLECSYSQLGPNQFSGSGLVMLNQQLGTEFDVHVKVTIRTHGKYLKFLDLKLNVCDTL
                     KASMSVPLIRKLYNNVLQSSNFPRKCPVKANVLYNISNLIVDRSYFPKYTPSPMDFNF
                     SIDYFVNEKKFAMLLLEGTTVPVRMK"
ORIGIN      
        1 catgttgcaa aatggtctat tctttcttat aatctggtat tgtttaaata caactgagac
       61 cgccgcaaat tggaatttca ttttaagttt tccccagtta atctgtaaac caattatacc
      121 tcaagtgata aaacgacttg aatgttccta tagccaattg ggaccaaatc aattttccgg
      181 cagtggtttg gtaatgctca atcaacagtt gggtacagaa ttcgatgtcc atgttaaagt
      241 gaccatcaga actcatggga aatatctaaa attcctagat ctgaaactca atgtatgtga
      301 tactttaaaa gcaagcatgt ctgtacctct tattagaaaa ctttacaata atgtccttca
      361 aagcagcaat tttccccgca aatgtccagt gaaggcgaat gttctctaca atatttccaa
      421 tttgattgtc gatagatcgt actttcccaa atatactccg tctcccatgg attttaattt
      481 ttcaatcgac tactttgtta atgaaaagaa atttgccatg cttctattag aaggcactac
      541 tgtgccagtt cgtatgaaat ga