Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367878 562 bp mRNA linear INV 02-SEP-2023 (LOC131997240), mRNA. ACCESSION XM_059367878 VERSION XM_059367878.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..562 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..562 /gene="LOC131997240" /note="uncharacterized LOC131997240; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997240" CDS 2..562 /gene="LOC131997240" /codon_start=1 /product="uncharacterized protein LOC131997240" /protein_id="XP_059223861.1" /db_xref="GeneID:131997240" /translation="MLQNGLFFLIIWYCLNTTETAANWNFILSFPQLICKPIIPQVIK RLECSYSQLGPNQFSGSGLVMLNQQLGTEFDVHVKVTIRTHGKYLKFLDLKLNVCDTL KASMSVPLIRKLYNNVLQSSNFPRKCPVKANVLYNISNLIVDRSYFPKYTPSPMDFNF SIDYFVNEKKFAMLLLEGTTVPVRMK" ORIGIN 1 catgttgcaa aatggtctat tctttcttat aatctggtat tgtttaaata caactgagac 61 cgccgcaaat tggaatttca ttttaagttt tccccagtta atctgtaaac caattatacc 121 tcaagtgata aaacgacttg aatgttccta tagccaattg ggaccaaatc aattttccgg 181 cagtggtttg gtaatgctca atcaacagtt gggtacagaa ttcgatgtcc atgttaaagt 241 gaccatcaga actcatggga aatatctaaa attcctagat ctgaaactca atgtatgtga 301 tactttaaaa gcaagcatgt ctgtacctct tattagaaaa ctttacaata atgtccttca 361 aagcagcaat tttccccgca aatgtccagt gaaggcgaat gttctctaca atatttccaa 421 tttgattgtc gatagatcgt actttcccaa atatactccg tctcccatgg attttaattt 481 ttcaatcgac tactttgtta atgaaaagaa atttgccatg cttctattag aaggcactac 541 tgtgccagtt cgtatgaaat ga