Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367866 604 bp mRNA linear INV 02-SEP-2023 (LOC106088558), mRNA. ACCESSION XM_059367866 VERSION XM_059367866.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..604 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..604 /gene="LOC106088558" /note="uncharacterized LOC106088558; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106088558" CDS 85..426 /gene="LOC106088558" /codon_start=1 /product="uncharacterized protein LOC106088558" /protein_id="XP_059223849.1" /db_xref="GeneID:106088558" /translation="MFSLKCVLLLASCVILVASSPVQFEEDVGHINSFPEGYEVVHLS RHARSPQHGSVDIGYSRDQRGREASVQYNHNLYTSRDGRGSIDAYAQGSRNFDHNRNN FGGGIQGKWRF" polyA_site 604 /gene="LOC106088558" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtagctgt gaccaatgca ttcaaagatt aaatcagcag tatcaacatc tcttgaacta 61 agaactcgtg aaatttaaaa aaaaatgttc tcattaaagt gtgtccttct tttggcatcg 121 tgtgtgatac tcgtcgcatc atcacctgtg caattcgaag aagatgttgg acatataaat 181 tcgtttccag aaggatatga agtggtgcat ttgtcgcgac atgcacgttc ccctcaacat 241 ggaagtgtag acatcggcta cagcagagat caacgcggac gtgaagcctc tgttcaatat 301 aaccataact tgtacaccag tcgcgatggt cgtggttcca tcgatgccta tgcccagggt 361 agccgcaatt ttgatcacaa tcgaaataac ttcggcggtg gtattcaagg aaagtggaga 421 ttttaaataa atttattgaa aattcttatt aagctaagac aaaataagca gatttggaaa 481 aaacaaaata tttttgagaa tataaataaa tatgtaaatt tctatacgaa tcaaatctca 541 atgtaatttg gaataaaatc tctatgaata gagatgggtt tccacccgat aaataccgaa 601 taaa