Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088558


LOCUS       XM_059367866             604 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088558), mRNA.
ACCESSION   XM_059367866
VERSION     XM_059367866.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..604
                     /gene="LOC106088558"
                     /note="uncharacterized LOC106088558; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106088558"
     CDS             85..426
                     /gene="LOC106088558"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088558"
                     /protein_id="XP_059223849.1"
                     /db_xref="GeneID:106088558"
                     /translation="MFSLKCVLLLASCVILVASSPVQFEEDVGHINSFPEGYEVVHLS
                     RHARSPQHGSVDIGYSRDQRGREASVQYNHNLYTSRDGRGSIDAYAQGSRNFDHNRNN
                     FGGGIQGKWRF"
     polyA_site      604
                     /gene="LOC106088558"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtagctgt gaccaatgca ttcaaagatt aaatcagcag tatcaacatc tcttgaacta
       61 agaactcgtg aaatttaaaa aaaaatgttc tcattaaagt gtgtccttct tttggcatcg
      121 tgtgtgatac tcgtcgcatc atcacctgtg caattcgaag aagatgttgg acatataaat
      181 tcgtttccag aaggatatga agtggtgcat ttgtcgcgac atgcacgttc ccctcaacat
      241 ggaagtgtag acatcggcta cagcagagat caacgcggac gtgaagcctc tgttcaatat
      301 aaccataact tgtacaccag tcgcgatggt cgtggttcca tcgatgccta tgcccagggt
      361 agccgcaatt ttgatcacaa tcgaaataac ttcggcggtg gtattcaagg aaagtggaga
      421 ttttaaataa atttattgaa aattcttatt aagctaagac aaaataagca gatttggaaa
      481 aaacaaaata tttttgagaa tataaataaa tatgtaaatt tctatacgaa tcaaatctca
      541 atgtaatttg gaataaaatc tctatgaata gagatgggtt tccacccgat aaataccgaa
      601 taaa