Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997234


LOCUS       XM_059367865             731 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997234), mRNA.
ACCESSION   XM_059367865
VERSION     XM_059367865.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..731
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..731
                     /gene="LOC131997234"
                     /note="uncharacterized LOC131997234; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997234"
     CDS             48..611
                     /gene="LOC131997234"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997234"
                     /protein_id="XP_059223848.1"
                     /db_xref="GeneID:131997234"
                     /translation="MKYLVAVILLIQAVARIPQTWSAEQYDADPDMVNVEVGSPDVID
                     IKLSIDRIARGYHGISGYFDIKQDIDTDQVLMHAKIYRSYNRNKYQNAVAAFEIRNQT
                     LTSFLNKAFKQYVYDDAQNCCTNVPQYETFESPLTKRYIECTKCRFSTEKWPNHLKNE
                     LYTVAFMFHGNVNFNLNVTFLVEPPRY"
     polyA_site      731
                     /gene="LOC131997234"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcaattgta tggttttgtc aactaagatt ccaccttaat ttcaatcatg aaatacctcg
       61 tcgcagttat acttctaata caagccgttg ctagaattcc tcagacttgg tctgctgagc
      121 aatacgatgc tgaccctgat atggtgaacg tggaagtcgg ctcccccgat gtgatagata
      181 ttaagttatc aattgatcga atagctcgag gataccacgg aatcagtgga tattttgata
      241 ttaagcagga catcgatact gaccaggtct taatgcacgc taaaatttac agaagctata
      301 acaggaataa ataccaaaat gctgtggcag ccttcgaaat aaggaaccaa acgcttacgt
      361 cctttttaaa taaggccttc aaacaatacg tttacgatga cgcccaaaac tgctgcacca
      421 atgttccgca atacgaaacg tttgaatcgc ctttgacgaa acgttatatc gaatgcacaa
      481 agtgcagatt ttccaccgaa aagtggccaa atcatttaaa aaatgaactt tacaccgttg
      541 catttatgtt ccatggaaat gttaacttca atttaaatgt gacattccta gtggaacctc
      601 ctagatacta gtgtcccaac attttcgccg tcacgcatag aaacgttgtt ggcaatgaca
      661 tttttttcat gtagttttaa agccgcggca agtatgcaat aaatattttt taatattctt
      721 tggagcagga a