Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367864 731 bp mRNA linear INV 02-SEP-2023 (LOC106092303), mRNA. ACCESSION XM_059367864 VERSION XM_059367864.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..731 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..731 /gene="LOC106092303" /note="uncharacterized LOC106092303; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106092303" CDS 48..611 /gene="LOC106092303" /codon_start=1 /product="uncharacterized protein LOC106092303" /protein_id="XP_059223847.1" /db_xref="GeneID:106092303" /translation="MKYLVAVILLIQAVARIPQTWSAEQYDADPDMVNVEVGSPDVID IKLSIDRIARGYHGISGYFDIKQDIDTDQVLMHAKIYRSYNRNKYQNAVAAFEIRNQT LTSFLNKAFKQYVYDDAQNCCTNVPQYETFESPLTKRYIECTKCRFSTEKWPNHLKNE LYTVAFMFHGNVNFNLNVTFLVEPPRY" polyA_site 731 /gene="LOC106092303" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctcaattgta tggttttgtc aactaagatt ccaccttaat ttcaatcatg aaatacctcg 61 tcgcagttat acttctaata caagccgttg ctagaattcc tcagacttgg tctgctgagc 121 aatacgatgc tgaccctgat atggtgaacg tggaagtcgg ctcccccgat gtgatagata 181 ttaagttatc aattgatcga atagctcgag gataccacgg aatcagtgga tattttgata 241 ttaagcagga catcgatact gaccaggtct taatgcacgc taaaatttac agaagctata 301 acaggaataa ataccaaaat gctgtggcag ccttcgaaat aaggaaccaa acgcttacgt 361 cctttttaaa taaggccttc aaacaatacg tttacgatga cgcccaaaac tgctgcacca 421 atgttccgca atacgaaacg tttgaatcgc ctttgacgaa acgttatatc gaatgcacaa 481 agtgcagatt ttccaccgaa aagtggccaa atcatttaaa aaatgaactt tacaccgttg 541 catttatgtt ccatggaaat gttaacttca atttaaatgt gacattccta gtggaacctc 601 ctagatacta gtgtcccaac attttcgccg tcacgcatag aaacgttgtt ggcaatgaca 661 tttttttcat gtagttttaa agccgcggca agtatgcaat aaatattttt taatattctt 721 tggagcagga a