Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367859 389 bp mRNA linear INV 02-SEP-2023 (LOC131997232), mRNA. ACCESSION XM_059367859 VERSION XM_059367859.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..389 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..389 /gene="LOC131997232" /note="uncharacterized LOC131997232; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997232" CDS 1..330 /gene="LOC131997232" /codon_start=1 /product="uncharacterized protein LOC131997232" /protein_id="XP_059223842.1" /db_xref="GeneID:131997232" /translation="MSSKRTLLSTSPDHKEHTPKKYAPSLNMSVSSHQDVFTWSKLCE VLDDKLKGVAKKEDLTDIKHEIEELKHENSKLKEDIKKLTNRLELVDQKSRTTNIMVP PAKSKGF" ORIGIN 1 atgagcagca agcgcactct tttatcgaca tcacctgatc ataaagaaca tacaccaaaa 61 aaatacgcgc cgtccctaaa tatgagtgta agcagtcatc aagacgtgtt tacatggagc 121 aaactatgcg aagtcctgga cgacaaattg aagggtgtag caaagaaaga agatctgacg 181 gatatcaaac atgaaattga agaattaaaa catgagaatt ctaaattaaa ggaagacata 241 aagaaattaa caaaccgtct agaactagtt gaccagaaat cgagaaccac aaatatcatg 301 gtaccgccag cgaagtccaa agggttttaa atgctagaag taaccttaag ggacaagcaa 361 tttttattca gaaggattac actgcagct