Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088562


LOCUS       XM_059367858             485 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088562), transcript variant X2, mRNA.
ACCESSION   XM_059367858
VERSION     XM_059367858.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..485
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..485
                     /gene="LOC106088562"
                     /note="uncharacterized LOC106088562; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088562"
     CDS             32..313
                     /gene="LOC106088562"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088562 isoform X2"
                     /protein_id="XP_059223841.1"
                     /db_xref="GeneID:106088562"
                     /translation="MKELTHEEMVFSTQQLLVCSGILMTNLWHLREKFIDPVCGVNYK
                     SLKGLLTLFQIPVYLIGWRKNLGSSEKIASVAINTIFNQMKLYAKRRIS"
     polyA_site      485
                     /gene="LOC106088562"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcttttatc gtaaacaaaa tcccacgtta aatgaaggaa ttgacacatg aagagatggt
       61 cttcagcacg cagcagttgt tagtttgtag tggcatactt atgacaaatt tgtggcatct
      121 acgagagaaa ttcattgatc cagtttgtgg agttaattat aagtctttaa aaggcttgtt
      181 aactctattt cagatccccg tttatttgat tggatggcgg aaaaatcttg gatcttcgga
      241 aaaaatagct tcagtagcca taaataccat ttttaaccag atgaagttgt atgctaagcg
      301 gcgcattagc tgagttgtta gcgaaatcaa cttaccagtg cgagggacga gggttcgatt
      361 tccgtcagct gctttggtct atacccaact gtggtatcac aatggaataa attatgagtc
      421 tgattgtaaa ctatgactgt acttcagcta acctatgttc tatgattata ttatctatta
      481 catta