Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367858 485 bp mRNA linear INV 02-SEP-2023 (LOC106088562), transcript variant X2, mRNA. ACCESSION XM_059367858 VERSION XM_059367858.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..485 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..485 /gene="LOC106088562" /note="uncharacterized LOC106088562; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088562" CDS 32..313 /gene="LOC106088562" /codon_start=1 /product="uncharacterized protein LOC106088562 isoform X2" /protein_id="XP_059223841.1" /db_xref="GeneID:106088562" /translation="MKELTHEEMVFSTQQLLVCSGILMTNLWHLREKFIDPVCGVNYK SLKGLLTLFQIPVYLIGWRKNLGSSEKIASVAINTIFNQMKLYAKRRIS" polyA_site 485 /gene="LOC106088562" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcttttatc gtaaacaaaa tcccacgtta aatgaaggaa ttgacacatg aagagatggt 61 cttcagcacg cagcagttgt tagtttgtag tggcatactt atgacaaatt tgtggcatct 121 acgagagaaa ttcattgatc cagtttgtgg agttaattat aagtctttaa aaggcttgtt 181 aactctattt cagatccccg tttatttgat tggatggcgg aaaaatcttg gatcttcgga 241 aaaaatagct tcagtagcca taaataccat ttttaaccag atgaagttgt atgctaagcg 301 gcgcattagc tgagttgtta gcgaaatcaa cttaccagtg cgagggacga gggttcgatt 361 tccgtcagct gctttggtct atacccaact gtggtatcac aatggaataa attatgagtc 421 tgattgtaaa ctatgactgt acttcagcta acctatgttc tatgattata ttatctatta 481 catta