Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088562


LOCUS       XM_059367857             561 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088562), transcript variant X1, mRNA.
ACCESSION   XM_059367857
VERSION     XM_059367857.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..561
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..561
                     /gene="LOC106088562"
                     /note="uncharacterized LOC106088562; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088562"
     CDS             36..389
                     /gene="LOC106088562"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088562 isoform X1"
                     /protein_id="XP_059223840.1"
                     /db_xref="GeneID:106088562"
                     /translation="MDLCYKSKHYHVNKYITRLSAGGKLEQLSCLTIAIMWRPWACLG
                     LFSCTNLWHLREKFIDPVCGVNYKSLKGLLTLFQIPVYLIGWRKNLGSSEKIASVAIN
                     TIFNQMKLYAKRRIS"
     polyA_site      561
                     /gene="LOC106088562"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaactattg atttgaaaat tttttgcacc acgtaatgga cttatgctac aaaagtaagc
       61 attatcatgt aaataaatac attacgcgat taagtgcggg cggtaaactt gagcaactga
      121 gctgcttaac aattgcaatt atgtggagac catgggcttg cttgggatta ttttcttgta
      181 caaatttgtg gcatctacga gagaaattca ttgatccagt ttgtggagtt aattataagt
      241 ctttaaaagg cttgttaact ctatttcaga tccccgttta tttgattgga tggcggaaaa
      301 atcttggatc ttcggaaaaa atagcttcag tagccataaa taccattttt aaccagatga
      361 agttgtatgc taagcggcgc attagctgag ttgttagcga aatcaactta ccagtgcgag
      421 ggacgagggt tcgatttccg tcagctgctt tggtctatac ccaactgtgg tatcacaatg
      481 gaataaatta tgagtctgat tgtaaactat gactgtactt cagctaacct atgttctatg
      541 attatattat ctattacatt a