Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans retinol dehydrogenase 13-like


LOCUS       XM_059367851            1128 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085328), mRNA.
ACCESSION   XM_059367851
VERSION     XM_059367851.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1128
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1128
                     /gene="LOC106085328"
                     /note="retinol dehydrogenase 13-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106085328"
     CDS             42..1076
                     /gene="LOC106085328"
                     /codon_start=1
                     /product="retinol dehydrogenase 13-like"
                     /protein_id="XP_059223834.1"
                     /db_xref="GeneID:106085328"
                     /translation="MSAMKVVDIRNKILYSVQLQMISLGKNAIYKYACWSLVSLLPMW
                     LYYKWREGPAYLKKNRIDGKVVIVTGSSTGIGKEIALELAKRGGRIYMACHEFEICER
                     ARQEIIQLSGNANVFNCLLDLSSLQSVRNFVKNFKQQEDRLDILINNAGILATPYKLT
                     EDGYEQQFAINHLGHFLLTNLLMDKLENSAPSRIVVLSSASYIFGQIQKDDINSEKSY
                     NAFKAYCSSKLANILFTRKLAKILRSSNIKVDVNCLHPGPVQSDITKNNAILKVASAL
                     GSKLLLRSTKMGAQTALYLALDPEVEGMSGGYYDRMSLAKLQRKAEDDEMADWLWEKS
                     AEMVKVKTNN"
     polyA_site      1128
                     /gene="LOC106085328"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtgaaaca attattaatc cgactgggaa aagtccgcaa catgtcagct atgaaagttg
       61 ttgatattag gaacaaaatc ttgtatagcg ttcaattgca aatgataagc ttaggaaaga
      121 atgcaatata taaatatgcc tgctggagtt tggtctcgct attgccaatg tggttgtatt
      181 acaaatggcg tgagggtcct gcgtacttaa agaaaaatcg catagatggt aaagtggtta
      241 tagtaaccgg cagcagtact ggcataggca aagaaatagc cttggaattg gccaaaaggg
      301 gtggtcgcat ctacatggcc tgtcatgaat ttgaaatatg tgaaagagct cgtcaggaaa
      361 taattcaact gtcgggcaat gcaaacgtct tcaattgcct attagatttg tcttctttgc
      421 aatcagtgcg taattttgta aaaaatttca aacaacaaga agatcgtttg gatatactca
      481 tcaataatgc agggattttg gctacacctt ataaactaac cgaggatggc tatgagcagc
      541 aattcgcaat caatcacttg ggtcattttt tacttacaaa tcttttaatg gataaattgg
      601 aaaattctgc tccaagtcgc atagtggttt tgagttctgc atcttatatt tttggccaaa
      661 ttcaaaagga tgatatcaat agcgagaaga gttataatgc ctttaaggct tattgctcta
      721 gcaagttggc gaatatttta tttacacgca aattagctaa aattttgaga agttcaaata
      781 ttaaagttga tgttaactgt ttacaccccg gccctgttca aagtgatata accaaaaata
      841 atgctatact aaaagtggcc agtgccttgg gttccaaact gctgttgcgt tcaacgaaaa
      901 tgggagctca aacggctttg tatttggctt tggaccctga agtggagggt atgtcaggag
      961 gttactatga tcgcatgtct ttggcgaaac tgcaaaggaa agctgaagat gatgaaatgg
     1021 ccgattggct gtgggaaaaa agtgctgaaa tggtaaaggt gaagactaac aactgacatg
     1081 agtcatttta tgattgaaat caagcaaata aaattttttt ctagttga