Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367820 946 bp mRNA linear INV 02-SEP-2023 (LOC131997226), mRNA. ACCESSION XM_059367820 VERSION XM_059367820.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..946 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..946 /gene="LOC131997226" /note="uncharacterized LOC131997226; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997226" CDS 1..774 /gene="LOC131997226" /codon_start=1 /product="uncharacterized protein LOC131997226" /protein_id="XP_059223803.1" /db_xref="GeneID:131997226" /translation="MENCNPVSTPMDVNVKLSKEMSPKTFAEVKEMSEIPYQQAIGSL LFASQCTRPDICLAVNKLSKFNKCPGKEHWSAVKRIFRYLKGTKGAKIKFSKGENEKL AAYSDSDWANDIDERRSVTGYICILQGGPISWVSKHQPTIALSTMEAEYMALSATVQE VIWLRNLNAELNPQSQDEPTEIYCDNQSAINLASTNKYLARSKHIDVRHHFVREKKDQ NIVNFVGIQTQFMVADNLTKPVPTDKHKFCSKQMGLQVI" polyA_site 946 /gene="LOC131997226" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggaaaatt gcaatcccgt atcgaccccg atggatgtca acgttaaact ttccaaggaa 61 atgtctccga aaacatttgc tgaagtcaag gaaatgtcgg aaataccata ccagcaagcg 121 attggtagtt tactgtttgc ttcgcaatgc acaagaccgg atatatgctt ggcagtcaac 181 aagctaagca aattcaacaa gtgtcccgga aaagaacatt ggtcagcagt caaacgaata 241 ttccgatatt taaaagggac gaaaggcgca aaaatcaaat tttctaaagg agaaaatgag 301 aaactggccg catattcaga ttcagactgg gcaaatgata ttgatgaaag aagatcagtg 361 actgggtaca tttgtatatt acaaggtgga ccaatatcct gggtttcaaa acatcaacca 421 actattgctc tttctacaat ggaagctgaa tatatggcgc tatctgctac ggtacaggaa 481 gttatatggc tgagaaattt aaatgcagaa ctcaacccac aatctcaaga tgaaccgacg 541 gagatatatt gcgataatca aagcgctata aatttggcat caactaataa gtatttagcg 601 agatcaaaac atatcgacgt tcgacatcat tttgtacgcg aaaaaaaaga tcaaaatata 661 gttaacttcg tgggaatcca aactcaattc atggtagcag ataatttaac aaagccagta 721 ccaactgaca agcacaaatt ttgttcaaaa caaatgggct tgcaagtaat ataaattttg 781 ttcgagtggg ggtgttagaa aagtactcat ttgaaaatgt acttgtgcga acaaaacaag 841 taggctttga ttttgtaaat tatttttttt ttgtttgttc ttgtctttga aacttatgtc 901 aataaaatat tttcttcatt gttatatcaa atcgttcaac tgaaaa