Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997226


LOCUS       XM_059367820             946 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997226), mRNA.
ACCESSION   XM_059367820
VERSION     XM_059367820.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..946
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..946
                     /gene="LOC131997226"
                     /note="uncharacterized LOC131997226; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997226"
     CDS             1..774
                     /gene="LOC131997226"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997226"
                     /protein_id="XP_059223803.1"
                     /db_xref="GeneID:131997226"
                     /translation="MENCNPVSTPMDVNVKLSKEMSPKTFAEVKEMSEIPYQQAIGSL
                     LFASQCTRPDICLAVNKLSKFNKCPGKEHWSAVKRIFRYLKGTKGAKIKFSKGENEKL
                     AAYSDSDWANDIDERRSVTGYICILQGGPISWVSKHQPTIALSTMEAEYMALSATVQE
                     VIWLRNLNAELNPQSQDEPTEIYCDNQSAINLASTNKYLARSKHIDVRHHFVREKKDQ
                     NIVNFVGIQTQFMVADNLTKPVPTDKHKFCSKQMGLQVI"
     polyA_site      946
                     /gene="LOC131997226"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggaaaatt gcaatcccgt atcgaccccg atggatgtca acgttaaact ttccaaggaa
       61 atgtctccga aaacatttgc tgaagtcaag gaaatgtcgg aaataccata ccagcaagcg
      121 attggtagtt tactgtttgc ttcgcaatgc acaagaccgg atatatgctt ggcagtcaac
      181 aagctaagca aattcaacaa gtgtcccgga aaagaacatt ggtcagcagt caaacgaata
      241 ttccgatatt taaaagggac gaaaggcgca aaaatcaaat tttctaaagg agaaaatgag
      301 aaactggccg catattcaga ttcagactgg gcaaatgata ttgatgaaag aagatcagtg
      361 actgggtaca tttgtatatt acaaggtgga ccaatatcct gggtttcaaa acatcaacca
      421 actattgctc tttctacaat ggaagctgaa tatatggcgc tatctgctac ggtacaggaa
      481 gttatatggc tgagaaattt aaatgcagaa ctcaacccac aatctcaaga tgaaccgacg
      541 gagatatatt gcgataatca aagcgctata aatttggcat caactaataa gtatttagcg
      601 agatcaaaac atatcgacgt tcgacatcat tttgtacgcg aaaaaaaaga tcaaaatata
      661 gttaacttcg tgggaatcca aactcaattc atggtagcag ataatttaac aaagccagta
      721 ccaactgaca agcacaaatt ttgttcaaaa caaatgggct tgcaagtaat ataaattttg
      781 ttcgagtggg ggtgttagaa aagtactcat ttgaaaatgt acttgtgcga acaaaacaag
      841 taggctttga ttttgtaaat tatttttttt ttgtttgttc ttgtctttga aacttatgtc
      901 aataaaatat tttcttcatt gttatatcaa atcgttcaac tgaaaa