Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans small ribosomal subunit protein mS25


LOCUS       XM_059367819             715 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081308), mRNA.
ACCESSION   XM_059367819
VERSION     XM_059367819.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..715
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..715
                     /gene="LOC106081308"
                     /note="small ribosomal subunit protein mS25; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106081308"
     CDS             124..627
                     /gene="LOC106081308"
                     /codon_start=1
                     /product="small ribosomal subunit protein mS25"
                     /protein_id="XP_059223802.1"
                     /db_xref="GeneID:106081308"
                     /translation="MSFMKGRAPIRRTLDYLNAGRLVLKDKVRIFSVNYNTYGEHHDG
                     ARDFVFWNIPQVQYKNPAVQVITLKNMTPSPFIRCYFEDGRDILIDVDSKNRHEIMDH
                     LMKVVGKTKEQLDAEARLAESKDNPANFGHGCNRHCICEIPGQVPCPAIVPLPDHMRG
                     KHIFAPK"
     polyA_site      715
                     /gene="LOC106081308"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattaggaac agctgttcca aatcaatgag aaaacttctc acacattgca agaacgatta
       61 agcaacttca acaacatttt attaaatttt ttcaataaaa ctttgtaaaa cccatactgc
      121 aacatgtctt ttatgaaagg tagagcaccc atacgccgta cccttgatta tttgaatgcc
      181 ggtcgtttgg ttttaaagga taaagtgaga atattcagtg tcaattacaa tacatacggc
      241 gaacatcatg atggtgcccg cgactttgtt ttctggaata tccctcaagt tcagtataaa
      301 aatcctgctg tacaggtaat aacattaaaa aatatgacac catcaccatt tatccgctgc
      361 tactttgagg atggccgtga tattctgata gatgtcgata gcaaaaatag acatgaaatt
      421 atggatcacc taatgaaggt ggtaggcaaa acgaaagaac aattggatgc cgaagctcgt
      481 ttggctgaga gtaaagacaa tcccgccaac tttggccatg gctgcaatcg ccattgcata
      541 tgtgaaattc ccggccaggt tccatgtcca gcaattgtgc cattgccaga tcatatgcgt
      601 ggcaaacata tatttgctcc aaaataaata taattagaat tgttgttgct attaaatttt
      661 gctaaaatac aattaagttt ttattagtcc ctctagcaat agggagattt gttaa