Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367819 715 bp mRNA linear INV 02-SEP-2023 (LOC106081308), mRNA. ACCESSION XM_059367819 VERSION XM_059367819.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..715 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..715 /gene="LOC106081308" /note="small ribosomal subunit protein mS25; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106081308" CDS 124..627 /gene="LOC106081308" /codon_start=1 /product="small ribosomal subunit protein mS25" /protein_id="XP_059223802.1" /db_xref="GeneID:106081308" /translation="MSFMKGRAPIRRTLDYLNAGRLVLKDKVRIFSVNYNTYGEHHDG ARDFVFWNIPQVQYKNPAVQVITLKNMTPSPFIRCYFEDGRDILIDVDSKNRHEIMDH LMKVVGKTKEQLDAEARLAESKDNPANFGHGCNRHCICEIPGQVPCPAIVPLPDHMRG KHIFAPK" polyA_site 715 /gene="LOC106081308" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cattaggaac agctgttcca aatcaatgag aaaacttctc acacattgca agaacgatta 61 agcaacttca acaacatttt attaaatttt ttcaataaaa ctttgtaaaa cccatactgc 121 aacatgtctt ttatgaaagg tagagcaccc atacgccgta cccttgatta tttgaatgcc 181 ggtcgtttgg ttttaaagga taaagtgaga atattcagtg tcaattacaa tacatacggc 241 gaacatcatg atggtgcccg cgactttgtt ttctggaata tccctcaagt tcagtataaa 301 aatcctgctg tacaggtaat aacattaaaa aatatgacac catcaccatt tatccgctgc 361 tactttgagg atggccgtga tattctgata gatgtcgata gcaaaaatag acatgaaatt 421 atggatcacc taatgaaggt ggtaggcaaa acgaaagaac aattggatgc cgaagctcgt 481 ttggctgaga gtaaagacaa tcccgccaac tttggccatg gctgcaatcg ccattgcata 541 tgtgaaattc ccggccaggt tccatgtcca gcaattgtgc cattgccaga tcatatgcgt 601 ggcaaacata tatttgctcc aaaataaata taattagaat tgttgttgct attaaatttt 661 gctaaaatac aattaagttt ttattagtcc ctctagcaat agggagattt gttaa