Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090689


LOCUS       XM_059367818             903 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090689), mRNA.
ACCESSION   XM_059367818
VERSION     XM_059367818.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..903
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..903
                     /gene="LOC106090689"
                     /note="uncharacterized LOC106090689; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106090689"
     CDS             179..739
                     /gene="LOC106090689"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090689"
                     /protein_id="XP_059223801.1"
                     /db_xref="GeneID:106090689"
                     /translation="MLNNVVLSMTRSRRQQHHHPPHHVAEEREEGGREGGTVSSSSSP
                     FLMKPLRMLLLMLMVLSAAATYIQPSMAESETNDLNSLEPKEPVTMSLKPISAKLETR
                     QHPNAAQYMPQSQLPATLPGCPLCDSSVYSYCSHKLIHDTCCCDYPGSIYQKPPQCVY
                     YECSLLYAKSCYEHSLIKNCCCNNPY"
     polyA_site      903
                     /gene="LOC106090689"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagatacaca aaccattcaa caaaccaaga gccaagcact cagccaggca ggcaggcagt
       61 cagtcagtcc gtcccccggt cccaattcga gtcacagtaa acggccagtc acagtcactt
      121 ttgtcgtctc catttatcca tctatccgtc catccatact ttcaatcata cgcacaacat
      181 gttgaacaat gtcgtgttgt cgatgacacg tagccgccgt caacaacatc accatcctcc
      241 tcaccatgtg gcagaagaac gtgaagaagg cggacgagaa ggtggaacag tctcatcgtc
      301 atcatcgcca tttctaatga aaccattacg gatgctgttg ctaatgttga tggtgctaag
      361 tgctgctgca acatacatac agccatcaat ggcagaaagt gaaactaatg atttgaatag
      421 tttggaaccc aaagagcccg tgaccatgtc gctaaaacca atttcagcca aactggaaac
      481 acgtcaacac cccaatgccg ctcagtacat gccccaatcg caattgccag caacattgcc
      541 tggctgtcca ttatgcgatt cgtccgtcta cagttattgt tcgcataaac tgattcacga
      601 cacatgctgc tgcgattatc caggttccat ttaccaaaag cctcctcaat gcgtctacta
      661 tgaatgctca ctgttgtatg caaaatcatg ctatgaacac tcgttaatta aaaattgctg
      721 ctgtaataat ccttattgag ggaacacttg taattataca tatttccact ttcgataata
      781 cgcttaggtt aagattaatt tatacaaaat gcccttaatg aataaagtca ttgaaatgat
      841 atgcgcagaa ggttgatgag tgcgttcata agccttatac tcaagaaacg tgtgaaaact
      901 taa