Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367818 903 bp mRNA linear INV 02-SEP-2023 (LOC106090689), mRNA. ACCESSION XM_059367818 VERSION XM_059367818.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..903 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..903 /gene="LOC106090689" /note="uncharacterized LOC106090689; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106090689" CDS 179..739 /gene="LOC106090689" /codon_start=1 /product="uncharacterized protein LOC106090689" /protein_id="XP_059223801.1" /db_xref="GeneID:106090689" /translation="MLNNVVLSMTRSRRQQHHHPPHHVAEEREEGGREGGTVSSSSSP FLMKPLRMLLLMLMVLSAAATYIQPSMAESETNDLNSLEPKEPVTMSLKPISAKLETR QHPNAAQYMPQSQLPATLPGCPLCDSSVYSYCSHKLIHDTCCCDYPGSIYQKPPQCVY YECSLLYAKSCYEHSLIKNCCCNNPY" polyA_site 903 /gene="LOC106090689" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagatacaca aaccattcaa caaaccaaga gccaagcact cagccaggca ggcaggcagt 61 cagtcagtcc gtcccccggt cccaattcga gtcacagtaa acggccagtc acagtcactt 121 ttgtcgtctc catttatcca tctatccgtc catccatact ttcaatcata cgcacaacat 181 gttgaacaat gtcgtgttgt cgatgacacg tagccgccgt caacaacatc accatcctcc 241 tcaccatgtg gcagaagaac gtgaagaagg cggacgagaa ggtggaacag tctcatcgtc 301 atcatcgcca tttctaatga aaccattacg gatgctgttg ctaatgttga tggtgctaag 361 tgctgctgca acatacatac agccatcaat ggcagaaagt gaaactaatg atttgaatag 421 tttggaaccc aaagagcccg tgaccatgtc gctaaaacca atttcagcca aactggaaac 481 acgtcaacac cccaatgccg ctcagtacat gccccaatcg caattgccag caacattgcc 541 tggctgtcca ttatgcgatt cgtccgtcta cagttattgt tcgcataaac tgattcacga 601 cacatgctgc tgcgattatc caggttccat ttaccaaaag cctcctcaat gcgtctacta 661 tgaatgctca ctgttgtatg caaaatcatg ctatgaacac tcgttaatta aaaattgctg 721 ctgtaataat ccttattgag ggaacacttg taattataca tatttccact ttcgataata 781 cgcttaggtt aagattaatt tatacaaaat gcccttaatg aataaagtca ttgaaatgat 841 atgcgcagaa ggttgatgag tgcgttcata agccttatac tcaagaaacg tgtgaaaact 901 taa