Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997218


LOCUS       XM_059367797             722 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997218), mRNA.
ACCESSION   XM_059367797
VERSION     XM_059367797.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..722
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..722
                     /gene="LOC131997218"
                     /note="uncharacterized LOC131997218; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997218"
     CDS             155..718
                     /gene="LOC131997218"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997218"
                     /protein_id="XP_059223780.1"
                     /db_xref="GeneID:131997218"
                     /translation="MLPKILFWVIALNCLITDQAAQQRNYNVELRQFICKCLKSRPVQ
                     QLECFFKKLETNRYYATGFVMLNQQLDKNLDVQVKFNIGSGKKIIKFLDVKLNICDTL
                     QRGASTPVIRRIIIELFKCSNLPRKCPIKPNFLFNASYILDDSYFPTYFPPSLDVNFT
                     VDFYDNHQKFAILLLQGSIVPKTKINK"
ORIGIN      
        1 gctaaatcga cgaataatac tcgtaatgac gctatttact cgtattacta tttatgcata
       61 taattatctt ggccacgaaa ataaatcaca tattcaaaac aatcgaaact atcatttcca
      121 agtttttcgc tgaagaaaaa cgagtactgc aacaatgctg cccaaaattc tattttgggt
      181 tattgccttg aactgtttga ttacagatca ggccgcccaa caaaggaact ataatgtgga
      241 gttgcgtcag tttatttgta aatgtctcaa atctcgacca gttcaacaac ttgaatgttt
      301 ctttaagaaa ttggaaacaa atcgatatta tgctaccggc tttgttatgc tcaatcagca
      361 attggataaa aatctcgatg tccaagtcaa atttaacata ggaagtggta aaaagataat
      421 taagttcctt gatgtgaagc tcaatatatg tgatacatta caacgaggag cctctacacc
      481 cgttatacgg agaattatta tcgaactctt taaatgtagc aatttacctc gaaaatgtcc
      541 cataaaaccg aactttctct tcaatgcatc ctacatcctc gatgattctt actttcccac
      601 atattttcca ccttcgttgg atgtcaactt cactgtagac ttttatgata atcaccaaaa
      661 gtttgcaata cttttgcttc agggtagcat tgtaccaaag acgaaaataa ataaatgaaa
      721 at