Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997209


LOCUS       XM_059367783            1334 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997209), mRNA.
ACCESSION   XM_059367783
VERSION     XM_059367783.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1334
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1334
                     /gene="LOC131997209"
                     /note="uncharacterized LOC131997209; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997209"
     CDS             153..1199
                     /gene="LOC131997209"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997209"
                     /protein_id="XP_059223766.1"
                     /db_xref="GeneID:131997209"
                     /translation="MVKAKKYNVDNRAGKKRIVCRVCLKDHPLRFCRKFLDMDYAERM
                     KIISIYQHCAGCLAHDHTWRTCESTGKCRKCGDMHHTLLHKPGPRSSTVMAYHDGARQ
                     GPQPSSKTPSKKGPRPSQSSHQHDGPSSSRRATNRGPSSSRGNRHKRPSSSQHAPKDK
                     PSKEVVPFDERRRKPYKGKNEMSTEVIPAYCLRETILLKATAVIKIVCGDRYIHERAV
                     IDPSIESSIVAESLVSRMGQRVVRVGNKTRCLLQIRGNHGMSATVETYAEVRRNHTVV
                     TPKKSIDVRIVDEFPGLQLADEHFYTSAPVSITLGGDLYPKIMRNGVFGGALGKPLAQ
                     FTIFGYVISGSYTP"
ORIGIN      
        1 ggttccagtg gtgttccacc agtgtttggt ttaattgttg ttgggatttt gcccttttgt
       61 tttgccgcgt aacataggtc cttcgagccg gatacgttgg aatacgagga tcacttttaa
      121 tctctcccac agattttggc caaatcagaa tcatggttaa agcaaaaaaa tacaatgtcg
      181 acaatcgggc cggcaaaaaa cgcatagttt gccgtgtttg ccttaaggac caccctctgc
      241 gattctgtcg taagtttttg gatatggatt atgcggaacg aatgaaaatt atttcgatat
      301 atcagcattg cgctggatgc ctagcacatg atcatacatg gcgcacatgt gaaagtactg
      361 gcaagtgtcg caaatgtggc gatatgcatc acacgcttct acacaaacct ggacctcgtt
      421 cgtccactgt gatggcgtat catgatggtg ctaggcaagg accacaacct tcgtccaaga
      481 ccccgtcgaa gaagggacct cgtccgtccc aatcttcaca tcagcatgat ggacctagtt
      541 cgtccagacg tgcaaccaat aggggaccta gttcgtcccg cggtaatcgg cacaagagac
      601 ctagttcgtc tcaacatgcc cccaaggaca aaccttcgaa ggaggtagta cctttcgatg
      661 aacggaggcg taagccgtac aaaggtaaaa atgagatgtc aacagaggta attccggcat
      721 actgcctacg agagaccata ctgctgaaag cgaccgctgt aataaagata gtttgtgggg
      781 atcgctacat acatgaacga gccgtaattg acccaagcat tgagagttct attgtagctg
      841 agtctttggt aagtcgaatg ggtcaaaggg tggtccgagt cggaaacaag acaagatgtc
      901 ttcttcaaat tcgaggcaat cacgggatgt cggcaacagt cgaaacatat gctgaagtgc
      961 gtcgtaatca cacagttgtg actccaaaga agtccattga tgtacgaatt gttgatgagt
     1021 ttcctggttt gcaattggca gacgagcatt tttatacctc agcacctgtg agtatcacgt
     1081 tgggaggaga tttgtaccca aaaataatgc ggaatggggt ctttggtggt gcactgggaa
     1141 aacctctggc acaattcaca atttttggat atgtgatatc aggttcttac actccctagt
     1201 ttcctgtaag acatcatgta tatgctttaa ccatggtacg atataataca atattttaaa
     1261 ccattgcagc ctacttcaat tggatttttt tctcacttcg gaacttggtg atttgttgga
     1321 ttttgaattt tgat