Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367752 461 bp mRNA linear INV 02-SEP-2023 (LOC106084115), mRNA. ACCESSION XM_059367752 VERSION XM_059367752.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..461 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..461 /gene="LOC106084115" /note="uncharacterized LOC106084115; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106084115" CDS 109..450 /gene="LOC106084115" /codon_start=1 /product="uncharacterized protein LOC106084115" /protein_id="XP_059223735.1" /db_xref="GeneID:106084115" /translation="MKSITALVIIGILIVSAAADVRYRGNAVHSDHPGQCYYEELKQA IPKNQSFSPVNLEDHCERIFCRSDYVLVMEYCGRHNLSPNATCAIRSDIRRPYPGCCP TLVCENESNFI" polyA_site 461 /gene="LOC106084115" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actacagtcg accattgtaa gtgtcttaag gaacatcaat aaagcggatt taaaaaaaaa 61 gtggttttaa gtttttaaaa atatacaaaa aaagaaaatt aaacaaaaat gaaatctata 121 acggctttag tgatcattgg cattttaatt gtttccgctg cagcggatgt tcgttatcgc 181 ggcaatgctg tacattcaga tcatcccggt cagtgttatt atgaagaatt aaaacaagcc 241 atacccaaaa atcaatcttt ctcccctgta aatttggaag atcattgtga gcgcatattt 301 tgccgttcgg attatgtgct ggtcatggaa tattgtggtc gccacaattt aagtcccaat 361 gcaacttgtg ccattcgcag tgatatacgt cgtccttatc ccggatgttg tcccaccttg 421 gtgtgtgaaa atgaaagtaa ttttatataa aacaaaaata a