Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084115


LOCUS       XM_059367752             461 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084115), mRNA.
ACCESSION   XM_059367752
VERSION     XM_059367752.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..461
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..461
                     /gene="LOC106084115"
                     /note="uncharacterized LOC106084115; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106084115"
     CDS             109..450
                     /gene="LOC106084115"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084115"
                     /protein_id="XP_059223735.1"
                     /db_xref="GeneID:106084115"
                     /translation="MKSITALVIIGILIVSAAADVRYRGNAVHSDHPGQCYYEELKQA
                     IPKNQSFSPVNLEDHCERIFCRSDYVLVMEYCGRHNLSPNATCAIRSDIRRPYPGCCP
                     TLVCENESNFI"
     polyA_site      461
                     /gene="LOC106084115"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actacagtcg accattgtaa gtgtcttaag gaacatcaat aaagcggatt taaaaaaaaa
       61 gtggttttaa gtttttaaaa atatacaaaa aaagaaaatt aaacaaaaat gaaatctata
      121 acggctttag tgatcattgg cattttaatt gtttccgctg cagcggatgt tcgttatcgc
      181 ggcaatgctg tacattcaga tcatcccggt cagtgttatt atgaagaatt aaaacaagcc
      241 atacccaaaa atcaatcttt ctcccctgta aatttggaag atcattgtga gcgcatattt
      301 tgccgttcgg attatgtgct ggtcatggaa tattgtggtc gccacaattt aagtcccaat
      361 gcaacttgtg ccattcgcag tgatatacgt cgtccttatc ccggatgttg tcccaccttg
      421 gtgtgtgaaa atgaaagtaa ttttatataa aacaaaaata a