Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367749 505 bp mRNA linear INV 02-SEP-2023 (LOC106086304), transcript variant X2, mRNA. ACCESSION XM_059367749 VERSION XM_059367749.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..505 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..505 /gene="LOC106086304" /note="large ribosomal subunit protein eL36; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 33 Proteins" /db_xref="GeneID:106086304" CDS 36..383 /gene="LOC106086304" /codon_start=1 /product="large ribosomal subunit protein eL36" /protein_id="XP_059223732.1" /db_xref="GeneID:106086304" /translation="MAVRYELCVGLNKGHKTTKIKNVKYTGTKKVKGLRGARLKNIQT RHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN ILTQMRKAQTHAK" polyA_site 505 /gene="LOC106086304" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgctaagg taggtggaca attgcgaaaa gcaaaatggc agtacgctac gaactctgtg 61 ttggtctcaa caagggtcac aagaccacca aaataaagaa tgttaaatac acaggaacca 121 agaaagtcaa aggcttgcgt ggtgctcgtt tgaagaacat ccaaacccgc cacactaaat 181 tcatgcgtga cttggtccgt gaagttgttg gtcatgctcc ctatgagaag agaactatgg 241 aattgttgaa ggtatctaag gataagcgtg ctttgaaatt cttgaaacgc cgattgggca 301 cacacatccg cgccaagagg aagcgtgaag aattgtccaa cattctcact caaatgagaa 361 aggctcaaac tcacgccaag taaataaaga actggctgtg atctgagttc atctatgttt 421 agtgtttacg ctattctgga tttttacttt gacagtagtg gtaatgataa acaaaaaatt 481 aataaaaaca gaaaattaaa atgta