Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans large ribosomal subunit protein eL36


LOCUS       XM_059367749             505 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086304), transcript variant X2, mRNA.
ACCESSION   XM_059367749
VERSION     XM_059367749.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..505
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..505
                     /gene="LOC106086304"
                     /note="large ribosomal subunit protein eL36; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 33 Proteins"
                     /db_xref="GeneID:106086304"
     CDS             36..383
                     /gene="LOC106086304"
                     /codon_start=1
                     /product="large ribosomal subunit protein eL36"
                     /protein_id="XP_059223732.1"
                     /db_xref="GeneID:106086304"
                     /translation="MAVRYELCVGLNKGHKTTKIKNVKYTGTKKVKGLRGARLKNIQT
                     RHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN
                     ILTQMRKAQTHAK"
     polyA_site      505
                     /gene="LOC106086304"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgctaagg taggtggaca attgcgaaaa gcaaaatggc agtacgctac gaactctgtg
       61 ttggtctcaa caagggtcac aagaccacca aaataaagaa tgttaaatac acaggaacca
      121 agaaagtcaa aggcttgcgt ggtgctcgtt tgaagaacat ccaaacccgc cacactaaat
      181 tcatgcgtga cttggtccgt gaagttgttg gtcatgctcc ctatgagaag agaactatgg
      241 aattgttgaa ggtatctaag gataagcgtg ctttgaaatt cttgaaacgc cgattgggca
      301 cacacatccg cgccaagagg aagcgtgaag aattgtccaa cattctcact caaatgagaa
      361 aggctcaaac tcacgccaag taaataaaga actggctgtg atctgagttc atctatgttt
      421 agtgtttacg ctattctgga tttttacttt gacagtagtg gtaatgataa acaaaaaatt
      481 aataaaaaca gaaaattaaa atgta