Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997193


LOCUS       XM_059367733            1512 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997193), transcript variant X2, mRNA.
ACCESSION   XM_059367733
VERSION     XM_059367733.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1512
                     /gene="LOC131997193"
                     /note="uncharacterized LOC131997193; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997193"
     CDS             455..1393
                     /gene="LOC131997193"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997193"
                     /protein_id="XP_059223716.1"
                     /db_xref="GeneID:131997193"
                     /translation="MAGYLPRPESPRPARPTRPRFDPREPRYRPASWQYACGLCQEDH
                     AIRSCPRFRQMTPYQRYETVERRSYCRNCLARSHLAPDCPVVTACRTCDYRHHTMLHG
                     APQLRKTYGSYSPPPMEIANPRQLAIEPANQMPIVQGPPPVEIPYSRATVFVPTAMVE
                     LAPEEQDDWAGVRVLLCQASTITRIAAATVTRLGIPTRERRGHRLATIRLRSRHASRR
                     TMYTIQAVVTRDLPRRPYSDPIIPDPTSSLRSLPLADADPRGNEPIDVEVGADAYAHL
                     RRSGVVQPGLGAVFAQETDWGYVFVGPVTSQARNQN"
ORIGIN      
        1 agaccctaac gatttagcac ccttgacccc agctcacttc cttataggct cttccctttt
       61 gaccccggca gaacccgaca tctcagagga ggacataacg cttgcaaatc ggtggaagag
      121 attaaagatt atatcccaaa acttttgtca gaggtggaag tcagagtact taaatgagct
      181 tcaccgtaga tacaaatgga agtatcagca agataacata caggtcaatg atttagttgt
      241 catcagggat gagagatatc ccaccgagtg gaagttagga cgagttttta aaacataccc
      301 cggtgttgat cagaacactc gagttgtaga tattcgaact tccaatggca tagtcagtcg
      361 acccataact aagattgtca aattattctc agacacccct agcaattcat aatcacatca
      421 aaacacggta ctcacgagat tttggttaca gataatggcc ggatatttac ctcgcccaga
      481 gtccccacga cccgccagac ccacacgccc tcgcttcgac ccacgggaac ccaggtatcg
      541 ccccgcatct tggcagtatg cctgtggcct ctgccaggag gaccacgcca tacggtcatg
      601 cccgcggttc cggcaaatga caccgtatca gagatacgag acagttgaga gacggagtta
      661 ctgtcggaac tgtctggcgc gcagccatct ggccccagac tgccccgtgg tcactgcctg
      721 ccgaacatgc gactaccgcc atcacacaat gctgcatgga gccccacagc ttaggaagac
      781 atacggcagc tacagcccgc ccccaatgga gattgccaac ccacggcaac ttgcaatcga
      841 accagccaac cagatgccca tcgtccaagg ccctcccccg gtcgagatac cttacagccg
      901 ggccactgtt tttgtaccca cggcgatggt ggaattggca cccgaggagc aggacgattg
      961 ggctggggta cgggtacttt tgtgccaggc atcgaccatc acccgaatcg cggcagccac
     1021 agtaactcgc ctggggatac caacgagaga gcgcagaggg caccgtctgg caacaataag
     1081 acttcggtca aggcatgcgt cgaggaggac catgtatacc atccaggcag tggtgacccg
     1141 ggatttgccg cgacgaccct attcagatcc catcattccc gaccccacaa gcagcctaag
     1201 atcccttcct ttggcagatg ctgaccctag gggcaacgaa ccaatcgatg tagaggtagg
     1261 ggccgatgcc tacgcccacc tccggaggag tggtgttgta caacccggat tgggagccgt
     1321 cttcgcccag gagacagatt ggggatacgt gttcgtcggc ccagtcacct cacaggcaag
     1381 aaaccaaaat taaaaagata caaagtgaca caataacaac cgactcaaaa accaaatcta
     1441 cactcgaccc acaattgcaa catcacaaca accataagtg cgggacacaa catacaacac
     1501 caactaattc ta