Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367733 1512 bp mRNA linear INV 02-SEP-2023 (LOC131997193), transcript variant X2, mRNA. ACCESSION XM_059367733 VERSION XM_059367733.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1512 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1512 /gene="LOC131997193" /note="uncharacterized LOC131997193; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997193" CDS 455..1393 /gene="LOC131997193" /codon_start=1 /product="uncharacterized protein LOC131997193" /protein_id="XP_059223716.1" /db_xref="GeneID:131997193" /translation="MAGYLPRPESPRPARPTRPRFDPREPRYRPASWQYACGLCQEDH AIRSCPRFRQMTPYQRYETVERRSYCRNCLARSHLAPDCPVVTACRTCDYRHHTMLHG APQLRKTYGSYSPPPMEIANPRQLAIEPANQMPIVQGPPPVEIPYSRATVFVPTAMVE LAPEEQDDWAGVRVLLCQASTITRIAAATVTRLGIPTRERRGHRLATIRLRSRHASRR TMYTIQAVVTRDLPRRPYSDPIIPDPTSSLRSLPLADADPRGNEPIDVEVGADAYAHL RRSGVVQPGLGAVFAQETDWGYVFVGPVTSQARNQN" ORIGIN 1 agaccctaac gatttagcac ccttgacccc agctcacttc cttataggct cttccctttt 61 gaccccggca gaacccgaca tctcagagga ggacataacg cttgcaaatc ggtggaagag 121 attaaagatt atatcccaaa acttttgtca gaggtggaag tcagagtact taaatgagct 181 tcaccgtaga tacaaatgga agtatcagca agataacata caggtcaatg atttagttgt 241 catcagggat gagagatatc ccaccgagtg gaagttagga cgagttttta aaacataccc 301 cggtgttgat cagaacactc gagttgtaga tattcgaact tccaatggca tagtcagtcg 361 acccataact aagattgtca aattattctc agacacccct agcaattcat aatcacatca 421 aaacacggta ctcacgagat tttggttaca gataatggcc ggatatttac ctcgcccaga 481 gtccccacga cccgccagac ccacacgccc tcgcttcgac ccacgggaac ccaggtatcg 541 ccccgcatct tggcagtatg cctgtggcct ctgccaggag gaccacgcca tacggtcatg 601 cccgcggttc cggcaaatga caccgtatca gagatacgag acagttgaga gacggagtta 661 ctgtcggaac tgtctggcgc gcagccatct ggccccagac tgccccgtgg tcactgcctg 721 ccgaacatgc gactaccgcc atcacacaat gctgcatgga gccccacagc ttaggaagac 781 atacggcagc tacagcccgc ccccaatgga gattgccaac ccacggcaac ttgcaatcga 841 accagccaac cagatgccca tcgtccaagg ccctcccccg gtcgagatac cttacagccg 901 ggccactgtt tttgtaccca cggcgatggt ggaattggca cccgaggagc aggacgattg 961 ggctggggta cgggtacttt tgtgccaggc atcgaccatc acccgaatcg cggcagccac 1021 agtaactcgc ctggggatac caacgagaga gcgcagaggg caccgtctgg caacaataag 1081 acttcggtca aggcatgcgt cgaggaggac catgtatacc atccaggcag tggtgacccg 1141 ggatttgccg cgacgaccct attcagatcc catcattccc gaccccacaa gcagcctaag 1201 atcccttcct ttggcagatg ctgaccctag gggcaacgaa ccaatcgatg tagaggtagg 1261 ggccgatgcc tacgcccacc tccggaggag tggtgttgta caacccggat tgggagccgt 1321 cttcgcccag gagacagatt ggggatacgt gttcgtcggc ccagtcacct cacaggcaag 1381 aaaccaaaat taaaaagata caaagtgaca caataacaac cgactcaaaa accaaatcta 1441 cactcgaccc acaattgcaa catcacaaca accataagtg cgggacacaa catacaacac 1501 caactaattc ta