Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_059367717             796 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088949), transcript variant X2, mRNA.
ACCESSION   XM_059367717
VERSION     XM_059367717.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..796
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..796
                     /gene="LOC106088949"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106088949"
     CDS             295..684
                     /gene="LOC106088949"
                     /codon_start=1
                     /product="lectin subunit alpha-like isoform X2"
                     /protein_id="XP_059223700.1"
                     /db_xref="GeneID:106088949"
                     /translation="MCKLLAVMGSLDEFDFSTATNECYRRGLQLAEIKNADKNAAMDI
                     LLRSLFAKTPDLWIGARDDGSSRKDRPFYWQKSKQRMVFGNWASGQPDNSQGVEHCVH
                     YYSATNFKWNDIKCDSKLGFICEGRFP"
     polyA_site      796
                     /gene="LOC106088949"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacttaaaat cgttaaagac atacaacttg agttaagaat ggtattttat gacgtccccg
       61 tgtccgtccg tgtttgtgaa gcaccatagc gatcgatagc gtaaagctag ccgctcgaaa
      121 ttctgcacag acattcttaa tgatgtagac ctctgcaaat agggcatagg gtgtttttga
      181 atgtgactcc cgtataaaag gtttttggag ccgcagtttt tatcctttta aaattttgcg
      241 tgtatagagt gatgcggcaa aatttaagtt gcttagcctt ctacgacctc tggtatgtgt
      301 aaacttttag ctgtgatggg ttccttagat gagtttgact tttctactgc taccaatgag
      361 tgttatcgac gtggtcttca attggccgaa attaaaaatg ccgacaaaaa tgctgccatg
      421 gatatcttgt taaggtcttt atttgctaaa actcctgatt tgtggattgg tgccagagac
      481 gatggatctt ctcgcaaaga tcgtcccttt tattggcaaa agtctaaaca gcgtatggtg
      541 tttggcaact gggctagtgg tcaacctgat aattcacaag gtgtcgaaca ttgcgttcac
      601 tattatagtg ccacaaattt caaatggaat gatatcaaat gtgattcaaa gttaggtttt
      661 atttgtgaag gtcgctttcc ctaatagaac ttaaatgtct tcacataaaa tcagaatcag
      721 aattgtttgc ataaaaaatg atattcgact ttccttttca ttaaaaacaa cttttatcaa
      781 aatatgcaat aagaaa